Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6C252P Olfactory Receptor

Gene Symbol OR6C252P
Organism Dog
Family 6
Subfamily C
Pseudo Yes
Location chr2:57457259-57458002 (-)

Sequence information


Nucleotide sequence

ATGTATTTCTTTCTTTGAAATTTTTCTTTCTTAGAAATTTCTTATACGACAGTCTGCATC
CCCAAATTGCTTGTAAGCATGGCCACTGGTGACAAAACCATTTCCTTTAACTGTTGTGCA
ACTCAGTTGCTTTGCCTTCCTTCTTGGAGCATCTGAATGTTACCTCCTGGCTGTCATGTC
CTACAATCGTTATGTAGCCATCTGCAAGCCCCTGCATTACACAACCATTATGAGCAGCAA
AATCTGTATCCAGCTAGTTCTTAGCTCTTGGATCACTGGTTTCCTCATCATCTTTCCAGG
ACTCATTTTAGGCTTAAGCCTGGACTTCTGTGATTCCAATGTCATTGATCATTTCTACTG
TGACACTGCTCCCCTCCTGCAGATCTCCTGCACAGACAGACACGTGTTGGAAATGATGAG
TTTCATCTTAGCTTTGGTGACTCTGCTGGTCACTTTGGCATTAGTAATTCTATCATACAC
ATATATTGCCCTAACAATTTTAAAAATTCCTTCTGCCAACCAGAGAAAAAAGCTTTCTCC
ACCTGTTCTTCTCACATGATTGTCATCTCCCTCTCATATGGCAGCTGCATCTTTATGTAC
CTTAAACCCTCAGTCAAACAGAGGATATCCTTGATGAAGGGAGTGGCAGTTCTCAATACT
TCTGTTGCTCCACTTTTGAATCCCTTTATTTATACTCTAAGGAAACAGCAGGTGAAGCAA
GCATTTTATTTTTCTGTTCCATTG


Conceptual translation

MYFFL*NFSFLEISYTTVCIPKLLVSMATGDKTISFNCCATQ\FAFLLGASECYLLAVM
SYNRYVAICKPLHYTTIMSSKICIQLVLSSWITGFLIIFPGLILGLSLDFCDSNVIDHFY
CDTAPLLQISCTDRHVLEMMSFILALVTLLVTLALVILSYTYIALTILKIPSANQRK/A
FSTCSSHMIVISLSYGSCIFMYLKPSVKQRISLMKGVAVLNTSVAPLLNPFIYTLRKQQV
KQAFYFSVPL