Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6C263P Olfactory Receptor

Gene Symbol OR6C263P
Organism Dog
Family 6
Subfamily C
Pseudo Yes
Location chrUn_AAEX03023286:8353-9267 (+)
Aliases cOR13P1

Sequence information


Conceptual translation

MRNHTVVTTFILLGLTDDPKIQVLLFVFLFLTYMLSVTGNLIIITLTLVDSNLKTPMYFF
L*NFSFLEVSFTTVCIPRFLYTMTTGDNTVSYNACATQLFFVVFFGATEFFLLAAMSYDR
YVAICKPLHYTTIMNNRVCTTLVLCCWFAGPLIILPPLGLGLQLEFCDSNVIDHFGCDAS
PILQITCSDTVLIERIVLSFAILTLIITLVCVVFSYTYIIKTILRFPSAQQRKKAFSTCS
SHMIVVSITYGSCIFIYIKPSAKEGVAINKVVSVLTTSVAPLFNPFIYTL*NKQVKDAFK
DTVKK