Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6C27 Olfactory Receptor

Gene Symbol OR6C27
Organism Dog
Family 6
Subfamily C
Pseudo No
Location chr27:40640-41575 (-)
Aliases cOR6C27

Sequence information


Nucleotide sequence

ATGAGGAATCAGTCAACAAAGATCGAGTTCATTCTCCTGGGACTGACCGATGACCCACAA
CTGCAAATTGTGATTTTTACATTTCTCTTCATCAACTATGTGCTGAGCATGACTGGAAAC
TTAACCATCATCCTTCTCACCCTGCTACATCCCAGCCTCAAGACTCCCATGTATTTTTTC
CTCCGAAATTTCTCCTTTATGGAAGCTTCACTGACAACAGTCTGTATTCCCAGATTCCTG
ATAAGCCTCATAACTAAAAACAAAGTCATTTCCTACAATTGTTGTGCATCTCAGTTATTC
TTTTTCCTCCAATTAGAAATTGCAGAATTTTACCTGCTGGCTGCCATGTCCTTTGACCGT
TATGTAGCAATCTGCAAACCCCTGCATTACCTGATCATCATGAACAACAAAATGTGCTAC
CAACTCCTGTTCAGCTCATGGGCCGTGGGCTTTCTGCTATCGTTTCCACCATTGGCTGTG
GGCCTCACACTGGATTTCTGTGCTTCCAGAGTAATCGATCATTTCATGTGTGACATTTCC
CCTGTGCTGCAGCTTTCCTGCACTGACACTCGTTTCTTGGAATTGCTTTCGTTTGTCTTA
TCTCTTGTAACACTTCTGATCACGTTGCTGTTACTGATTCTTTCTTACACATACATTATC
AAGACCATTCTCAAGATCCCCTCTGCTCAGAAAAGAACCAAGGCTTTTTCTACTTGTTCT
TCTCATATGATTGTGGTCTCCCTTACGTATGGTAGCTGCATCTTTAATTACCTAAAGCCA
ACAGCGAAGGAAAGGGTGACTTTGTCCAAAGGTGTAAGTGTTATTTATACCTCGGTTGCC
CCTTTATTAAACCCTTTCATTTACAGTCTCAGAAACCAACAAGTCAAACAAGCCTTCAAG
GATGCACGCCAAAAGATTTGCTCTTTTTCCAAAAAA


Conceptual translation

MRNQSTKIEFILLGLTDDPQLQIVIFTFLFINYVLSMTGNLTIILLTLLHPSLKTPMYFF
LRNFSFMEASLTTVCIPRFLISLITKNKVISYNCCASQLFFFLQLEIAEFYLLAAMSFDR
YVAICKPLHYLIIMNNKMCYQLLFSSWAVGFLLSFPPLAVGLTLDFCASRVIDHFMCDIS
PVLQLSCTDTRFLELLSFVLSLVTLLITLLLLILSYTYIIKTILKIPSAQKRTKAFSTCS
SHMIVVSLTYGSCIFNYLKPTAKERVTLSKGVSVIYTSVAPLLNPFIYSLRNQQVKQAFK
DARQKICSFSKK