Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6C2F Olfactory Receptor

Gene Symbol OR6C2F
Organism Dog
Family 6
Subfamily C
Pseudo No
Location chrUn_AAEX03023213:8836-9771 (+)
Aliases cOR6C37

Sequence information


Conceptual translation

MRNHTAVTTFILLGLTDDPKIQVLLFVFLFLTYMLSVTGNLIIITLTLVDSHLKTPMYFF
LRNFSFLEVSFTTVCIPRFLYTMTTGDNTVSYNACATQLFFVVLFGATEFFLLAAMSYDR
YVAICKPLHYTTIMNNRVCTTLVLCCWFAGLLIILPPLGLGLQLEFCDSNVIDHFGCDAS
PILQITCSDTVLIERIVLSFAVLTLIITLVCVVLSYTYIIKTILRFPSAQQRKKAFSTCS
SHMIVVSITYGSCIFIYIKPSAKEGVAINKVVSVLTTSVAPLFNPFIYTLRNKQVKDAFK
DTVKWIVFLTKK