Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6C4 Olfactory Receptor

Gene Symbol OR6C4
Organism Dog
Family 6
Subfamily C
Pseudo No
Location chr8:705870-706793 (+)
Aliases cOR6C4

Sequence information


Nucleotide sequence

ATGAAAAACAGGACGTTTACTGAGTTTATTCTGTTGGGCTTCACAAATCAACCTGATATC
CAGGTTGTCATATTCATCTTTCTTTTCATCACCTACATACTAAGTGTCCTAGGAAATTTG
ACTATCATCATTCTCACTCTAGTAGATCCTCACCTCCAGACCCCCATGTATTTCTTCCTC
CGGAATTTCTCCTTCTTAGAAGTTTCTTTCACATCCATTTTTATTCCCAGATTTCTGACC
AGCGTGACAACAGGAAATAAAGTCATCAGTTTTGCTGGATGCTTGGTTCAATATTTTTTT
GCTATATTTCTTGGGGCAACAGAGTTTTATCTCTTGGCTTCTATGTCCTATGACCGCTAT
GTTGCCATATGCAAACCCCTGCATTATCTGATCATTATGAGCAATCGGGTCTGCATACAA
CTCGTGTTCTGTTCCTGGCTGGGAGGATTCCTAGCTATCTTACCCCCAATCATCCTGATG
AGCCAGGTGGATTTCTGTGCCTCCAATATTCTGAATCACTATTACTGTGATTATGGGCCC
CTTCTGGAGCTTGCCTGCTCAGACACAAGCATCCTAGAAGTGATGGTCATCTTCTTGGCA
GTTGTGACTCTGGTGGTTACTCTACTGCTGGTGACATTTTCTTATACGTACATTATCAGG
ACCATTTTGAGGATCCCTTCTGCCCAGCAAAGGAAAAAGGCTTTTTCTACTTGTTCTTCC
CACATGATTGTCATATCCCTCTCTTATGGCAGCTGCATGTTTATGTACATTAATCCCTCT
GCAAAAGAAGAAGGTTCTTTCAACAAAGGAATAGCTGTACTCATTACCTCAATTACTCCG
TTGTTAAACCCCTTCATTTATACTCTAAGAAATCAGCAAGTGAAGCAAGCATTCAAGGAT
GCTGTCAAAAAGATTGTGAAGCTT


Conceptual translation

MKNRTFTEFILLGFTNQPDIQVVIFIFLFITYILSVLGNLTIIILTLVDPHLQTPMYFFL
RNFSFLEVSFTSIFIPRFLTSVTTGNKVISFAGCLVQYFFAIFLGATEFYLLASMSYDRY
VAICKPLHYLIIMSNRVCIQLVFCSWLGGFLAILPPIILMSQVDFCASNILNHYYCDYGP
LLELACSDTSILEVMVIFLAVVTLVVTLLLVTFSYTYIIRTILRIPSAQQRKKAFSTCSS
HMIVISLSYGSCMFMYINPSAKEEGSFNKGIAVLITSITPLLNPFIYTLRNQQVKQAFKD
AVKKIVKL