Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6C42 Olfactory Receptor

Gene Symbol OR6C42
Organism Dog
Family 6
Subfamily C
Pseudo No
Location chr27:24940-25911 (-)
Aliases cOR6C42

Sequence information


Nucleotide sequence

ATGAGAAACCATACAATGATTACAGAGTTCGTTCTCTTGGGCATCTCAGATGACCCACAG
CTTCAGGTTGTAATCTTTATCTTTTTATTTATGGCTTATGTATTAAGTGTCACTGGAAAC
CTAACCATCATCATCCTCACCTTGATAGACTGTCATCTCAAGACTCCTATTTATTATTTC
CTGCAGAATTTCTCCTTCTTAGAAATTACATTCACCAGTGTTTGTATCCCCAGATTTTTG
GGGACAATCGTTACTAAAATCAAGACTGTTTCCTATAACAGTTGTGTAGCTCAACTATTT
TTTATCATCCTCACGGGTGTTACTGAATTTCCCCTTCTCACTGTCATGGCTTTTGATCGT
TATGTTGCCATCTGTAAGCCTCTTCATTATATCATCATCATGAACAAGAAAATCTGTACC
CTGCTTGTCTTTGGGTCCTGGTTACTAGGATTTCTTACCATTTTCCCACCACTCATCCTC
ATCCTCCAGCTAGATTTCTGTGCTTCCAACGTAATTGATCATTTCTGTTGTGACTATTTC
CCCATTTTACAACTCTCATGCTCAGATACATGGCTTTTAGAGATGATTGGCTTTTACTTC
GCTTTTGTTATTCTTTTCTTCACATTGGCATTAGTGATTCAATCCTACGTGAGCATCCTT
AGCACCATTCTGAGACTCCCATCTGCTAGTCAAAGGAAAAAGGCTTTATCCACGTGTTCC
TCTCACTTGATTGTCATTTCCATCTCTTATGGGAGCTGTATATTCATGTATGTCAAGCCT
TCAGCAAAAGAAAGAGCATCACTGACCAAAGGAGTAGCTATTCTCAACACCTCGATTGCC
CCCATGTTGAACCCTTTTATTTATACCCTGAGGAACCAGCAAGTTAAACAAGCTTTGAAG
AACTTGCTTCACAAAGTAGCATTTTCTATCAGAGAGGGAGACAAAACATGGAAGACTCCT
AACTCTGGGAAA


Conceptual translation

MRNHTMITEFVLLGISDDPQLQVVIFIFLFMAYVLSVTGNLTIIILTLIDCHLKTPIYYF
LQNFSFLEITFTSVCIPRFLGTIVTKIKTVSYNSCVAQLFFIILTGVTEFPLLTVMAFDR
YVAICKPLHYIIIMNKKICTLLVFGSWLLGFLTIFPPLILILQLDFCASNVIDHFCCDYF
PILQLSCSDTWLLEMIGFYFAFVILFFTLALVIQSYVSILSTILRLPSASQRKKALSTCS
SHLIVISISYGSCIFMYVKPSAKERASLTKGVAILNTSIAPMLNPFIYTLRNQQVKQALK
NLLHKVAFSIREGDKTWKTPNSGK