Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6C49P Olfactory Receptor

Gene Symbol OR6C49P
Organism Dog
Family 6
Subfamily C
Pseudo Yes
Location chr10:16465860-16466533 (-)
Aliases cOR6C49

Sequence information


Nucleotide sequence

AAAACCATTTCCTTTAATTGCTTGCAGCTCAATTGTTTTTTACCTTCCTTCTTGGTGCAT
CTGAACTTTGTTTGCTGGCAGCTATGTCCTATGACCACTATGTTGCCATTTGTAAGCACC
TGCATTACACAACCATCATGAGCAGTAAGATCTGCACACAAGTTGTCTTCTGTTGTCGGT
TTGCTGGGTCTTTTGTCATCTTTCCACCTCTCCTCTTAGACTTAAATCTTGGCTTCTATG
CCTTCAACATTGTTGATCATTTCTACTGTGCCACAACCCCCCTGCTGCAGATCTCCTGCT
TAGACACACAGCTCTTAGAGACAATGGGATACATCTCTGCTTTGGTGACACTCACAGTCA
CATTGGTAATGGTGATAATATCATATACCTACATTGTATTAAGAATTCTAAAAATCTTTT
CAGTCAATCAGAGGAAAAAGGCTTTTTCAACATGTTCTTCTCACATGACTGTGATATCCC
TTTCTTATGGCAGCTGCATCTTCATGTATGTTAAGCCATCAGCCAAACAAAGAACATCTT
ATTCCAAGGGAATTGCAGTGCTCAACACGTCTGTTGCTCTACTTTTGAATCCTTTCATCT
ACACTTTGTGGAACAAGCAAGTAAAAACAGCCTTCATGAACATGGTACACAAAATTGTTT
CTTTCTCGAACAAA


Conceptual translation

KTISFNC/AAQLFFTFLLGASELCLLAAMSYDHYVAICKHLHYTTIMSSKICTQVVFCC
RFAGSFVIFPPLLLDLNLGFYAFNIVDHFYCATTPLLQISCLDTQLLETMGYISALVTLT
VTLVMVIISYTYIVLRILKIFSVNQRKKAFSTCSSHMTVISLSYGSCIFMYVKPSAKQRT
SYSKGIAVLNTSVALLLNPFIYTLWNKQVKTAFMNMVHKIVSFSNK