Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6C69G Olfactory Receptor

Gene Symbol OR6C69G
Organism Dog
Family 6
Subfamily C
Pseudo No
Location chr27:112712-113644 (+)
Aliases cOR6C47

Sequence information


Nucleotide sequence

ATGGAAAACCATACAACTGTGACAGTATTTATCTTAGCAGGATTGACGGAGGACCCAAAA
CTGAAGATTGTGCTATTTGTCTTCCTGCTCCTCACCTATTTGCTAAGCATCTCAGGCAAC
TTAGTCATTATTACCCTCACTTTGCTGGACTCCCATCTCAAGACCCCTATGTATTTCTTT
CTTCGAAATTTTTCTTTCTTAGAAATTTCTTATACGACAGTCTGCATCCCCAAATTGCTT
GTAAGCATGGCAACCGGTGACAAAACCATTTCCTATAACTGTTGTGCAACTCAGTTATTT
TTTGCCTTCCTTCTTGGAGCATCTGAATTTTACCTCCTGGCTGTCATGTCCTATGATCGT
TATGTCGCCATCTGCAAGCCCCTGCATTACACAACCATTATGAGCAGCAAAATCTGTATC
CAGCTAGTCCTTAGCTCTTGGATCACTGGTTTCCTCATCATCTTTCCAGGACTCATTTTA
GGCTTAAGCCTGGACTTCTGTGATTCCAATGTCATTGATCATTTCTACTGTGACACGGCT
CCCCTCCTGCAGATCTCCTGCACAGACACACACGTGTTGGAAATGATGAGTTTCATCTTA
GCTTTGGTGACTCTGCTGGTCACTTTGGCCTTAGTGATTCTATCGTACACATATATCGCC
CTGACAATTTTAAAAATTCCTTCTGCCAACCAGAGAAAAAAGGCTTTCTCCACCTGTTCT
TCTCACATGATTGTCATCTCCCTCTCATACGGCAGCTGCATCTTTATGTACATTAAACCC
TCGGTCAAACAGAGGATATCCTTGATGAAGGGGGTGGCAGTTCTCAATACTTCTGTTGCT
CCACTTTTGAATCCCTTTATCTATACTCTAAGGAACCAGCAGGTGAAGCAAGCATTTAAG
AACTTGCTACAAAGAGTTCTGTCTTTATTCAAA


Conceptual translation

MENHTTVTVFILAGLTEDPKLKIVLFVFLLLTYLLSISGNLVIITLTLLDSHLKTPMYFF
LRNFSFLEISYTTVCIPKLLVSMATGDKTISYNCCATQLFFAFLLGASEFYLLAVMSYDR
YVAICKPLHYTTIMSSKICIQLVLSSWITGFLIIFPGLILGLSLDFCDSNVIDHFYCDTA
PLLQISCTDTHVLEMMSFILALVTLLVTLALVILSYTYIALTILKIPSANQRKKAFSTCS
SHMIVISLSYGSCIFMYIKPSVKQRISLMKGVAVLNTSVAPLLNPFIYTLRNQQVKQAFK
NLLQRVLSLFK