Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6C78P Olfactory Receptor

Gene Symbol OR6C78P
Organism Dog
Family 6
Subfamily C
Pseudo Yes
Location chr10:16503996-16504929 (-)

Sequence information


Nucleotide sequence

ATGGGAAACCAGACATCAGTGATAGAATTCATTCTTCTTGGACTGACGAATGACACTGAG
CTTCAAGCTGTGCTTTTCCTTTTTCTGCTGCTAACTTATGTCTTAAGCATCATGGGAAAC
TTGACCATCATCATTCTGGCCCTTTTGGATTATCGCCTTCAGACTCCTATGTATTTCTTT
TTCCGGAATTTTTCTGTTTTGGAAGTATCTTTTACTTCTGTCTTTGTTCCCAAAATGCTA
GTCAATATTGCAACTGGAGACAAGACTATCTCCTTCGCTGGTTGTTTCACTCAGAATTTT
TTTGCCATCCTTCTGGGGCAACTGAATTTTATCTTTTAGCTGCCATGTCCTATGATTGCT
ATGTTGCCATTTGTAAACCCTTGCATTATACAACTGTAATGAGCAGGAAACTGCATTCAG
CTTGTTCTGTGTTCCTGGTTCTCTGGTTTTTTGGTTGTCATTGTGCCACATACAATGACT
CTCCAACTGCCTTTCTGTGTCTCCAATGTCATCAATCATTGATGCTGTGACTATCCCATA
CTGCTGCATCTGTCCTGTTCAGACACACAGTTCATAGAAGTGATGGAATTTATCTTTGCT
ACAGTTACCCTCATCTTCACCTTGGTGCTAGTGATTCTTTCCTACACGTACATAATCAGG
ACAATTCTGAGAATCCCTTCTGTTCAACAAAGAAAAAAAAGCCTTTTCTACATGCTCCTG
TCACATGATTGTGGTCTCACTTTCATATGGAAGTTGTATCTTTATGTACATAAATCCTTC
TGTTAAGGATGCAGAAACTTTTAATAAGAGAGTGGCTGTTTTAAATACCTCAGTTGCCCC
TCTGTTGAACACTTTCATCTATACCCTAAGGGAAAAGCAAGTGAAAATAGCCTTCAAAGA
CATGGTCAGCAAGATAATGATGTTTTCAGGAAAA


Conceptual translation

MGNQTSVIEFILLGLTNDTELQAVLFLFLLLTYVLSIMGNLTIIILALLDYRLQTPMYFF
FRNFSVLEVSFTSVFVPKMLVNIATGDKTISFAGCFTQNFFAILL/ATEFYLLAAMSYD
CYVAICKPLHYTTVMSRK\IQLVLCSWFSGFLVVIVPHTMTLQLPFCVSNVINH*CCDY
PILLHLSCSDTQFIEVMEFIFATVTLIFTLVLVILSYTYIIRTILRIPSVQQRKKSL\T
CSCHMIVVSLSYGSCIFMYINPSVKDAETFNKRVAVLNTSVAPLLNTFIYTLREKQVKIA
FKDMVSKIMMFSGK