Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6D4P Olfactory Receptor

Gene Symbol OR6D4P
Organism Dog
Family 6
Subfamily D
Pseudo Yes
Location chr28:2332024-2332752 (-)
Aliases cOR6D4P

Sequence information


Nucleotide sequence

TTTCCTCACATCCAGCACCTGGGAAAGTTTCTCTTCCTGGTGCACCTGCTGACATACCTG
GCATCCATTGCAGGCAATGCTGTCATAGTCACCATCATCTGTGCTAATTCCCGGCTCCAG
ACACCGATGTACTTTTTCCTCAGCATTTTCTCCTTCTTGGAGTGTTACTTCATAAATACT
GTTATTCCTAAGTTATTGGTCATCTTTCTTTCAGGTAAGCAAACCATTTCTTTTCCTGCC
TGTTTCATACAAGCCTTTGTCTTTGTATTTCTGGAAGCAGCAGGTTTCTTCCTCATAGCA
GTGATGTCTCTGGATTGGTATGTGGCCATTTGCAAGCCCCTGCATTACCCGACCATCATG
AACCTGAAGACTAGTTCCCTCCTGGTCACTGCCTGCTGTGCTTTGGGGTTCTCTCTAATC
ACTGGTCTGGTAGTAAAGGTTTCCCAGTTATCCTTCTGTGGTCCCCATGTCATCCCCCAC
TTTTTTTGTGACCTTGGCCCCCTGATTCATCTCTTCTGTTCTGACACCAAGTCTGTTGAA
ATGTTGATCTCTGTCCTTGCTTTGTTAATCCTTTTGACATCCCTTATCATAACCATCATT
GACTATAGCAACATAGTAGTCACAATCCTGAAACTCCCATCAGCCAAGGAGAAAAAGAAA
GCTTTCTCCACCGGCTCCTCTCACCTCATAGTCCTCTCTCGAATGTATGGAAGCTGTGTC
TTTTTTTTA


Conceptual translation

FPHIQHLGKFLFLVHLLTYLASIAGNAVIVTIICANSRLQTPMYFFLSIFSFLECYFINT
VIPKLLVIFLSGKQTISFPACFIQAFVFVFLEAAGFFLIAVMSLDWYVAICKPLHYPTIM
NLKTSSLLVTAC\L/GFSLITGLVVKVSQLSFCGPHVIPHFFCDLGPLIHLFCSDTKS
VEMLISVLALLILLTSLIITIIDYSNIVVTILKLPSAKEKKKAFSTGSSHLIVLSRMYGS
CVFFL