Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6D5 Olfactory Receptor

Gene Symbol OR6D5
Organism Dog
Family 6
Subfamily D
Pseudo No
Location chr28:2384754-2385731 (-)
Aliases cOR6D5

Sequence information


Nucleotide sequence

ATGTATAATGATGTACGTATGATGCTGTGGAAAGAGATGCCCATGGAAATGGAGAATGGG
ACAGCTGTCCAGGAATTCACCTTGGAAGGGTTCCCTGACATCCAGCACCTGGGAAAGTTT
CTCTTCCTGGTGCACCTGCTGACATACCTGGCATCCATTGCAGGCAATGCTGTCATAGTC
ACCATCATCTGTGCTAATTCCCGGCTCCAGACACCTATGTACTTTTTCCTCAGCATTTTC
TCCTTTGTAGAGTGTTGTTTCATAAATACTGTTATTCCTAAGTTGTTAGTCATCTTTCTT
TTAGGCAAGCAAAACATTTCCTTTCCTGCCTGTTTCATACAAGCCTTTTTCTTTTTCTTT
CTGGGAGCAGCAGATTTCTTTCTCATAGCAGTGATGTCTCTGGATCGGTATGTGGCCATT
TGCAAGCCCCTGCATTACTTGACCATCATGAACCTGAAGACTTGCTCCTTTCTGGTCACT
ACCTGCTTCACTTTGGCCTTCACTCTCATCACTGGTTTGGTAGTGAAAGTTTCCCAGTTA
TCCTTCTGTGGCCCCTATGTCATCCCTCACTTTTTCTGTGACATTGGCCCCCTGATTCAT
CTTTCCTGTTCTGACACTAAACCTACTGAAATGTTGGCTTTTGTCCTCGCTTTGTTTATC
CTTTTGACATCCCTTATCATAACCATCATTGCCTACAGCAACATAATAGTCACAATTGTA
CAACTCCCATCAGCTAGGGAACGACAGAAAGCTTTCTCCACCTGCTCCTCTCACCTTATA
GTCCTCTCTCTGATGTATGGCAGCTGTGTCTTTATATATGTAAAACTAAAGCAAACGAAC
AGGATGGACTCCAACAGGGAGGCTGCCCTTGTGAACACGGTGGTGACCCCGCTGCTCAAC
CCTGTCATTTACACTCTGCGGAACAAGCAGGTCCACCAGGCTCTGAGAGAGACAATGTGC
AGAATGAAAATGTCAAGA


Conceptual translation

MYNDVRMMLWKEMPMEMENGTAVQEFTLEGFPDIQHLGKFLFLVHLLTYLASIAGNAVIV
TIICANSRLQTPMYFFLSIFSFVECCFINTVIPKLLVIFLLGKQNISFPACFIQAFFFFF
LGAADFFLIAVMSLDRYVAICKPLHYLTIMNLKTCSFLVTTCFTLAFTLITGLVVKVSQL
SFCGPYVIPHFFCDIGPLIHLSCSDTKPTEMLAFVLALFILLTSLIITIIAYSNIIVTIV
QLPSARERQKAFSTCSSHLIVLSLMYGSCVFIYVKLKQTNRMDSNREAALVNTVVTPLLN
PVIYTLRNKQVHQALRETMCRMKMSR