Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6Q1 Olfactory Receptor

Gene Symbol OR6Q1
Organism Dog
Family 6
Subfamily Q
Pseudo No
Location chr18:38284205-38285155 (-)
Aliases cOR6Q2, cOR6Q2

Sequence information


Nucleotide sequence

ATGCAGCCATATGCCCAAAACTGGACCCATGTAACAGAGTTTGTCATGGTGGGCTTTGCT
GGGGTGCATGAAGCACGCCTTCTCTTCTTTACAGTCTTTCTCACCATGTACCTGTTCACC
TTGGTGGAGAACTTGGCCATCATCTTGGTGGTGGCTTTGAACCATCGGCTACACAGACCC
ATGTATTTCTTCCTGACACACTTGTCCTGCCTTGAAATTTGGTACACTTCAGTGACGGTG
CCTAAGATGCTGGCTGGTTTTATTGGGGTAGATGGGGGCAAGAATATCTCCTACACTGGC
TGTCTATCCCAACTCTTCATCTTTACCTTCCTGGGGGCAACTGAGTGTTTTCTACTGGCT
GCCATGGCCTATGACCGCTATGTGGCCATTTGTATGCCTCTTCGATATGGGGCCTTGGTG
TCGTGGGGCACCTGCATCCGTCTGGCAGCTGCTTGTTGGCTGGTGGGCCTCCTCACACCT
GTTTTGCCTATCTACCTCATGTCCCAGCTGACATTTTGTGGTCCCAATGTCATCGACCAC
TTCTTCTGTGATGTCTCACCACTGCTAGCCTTGTCCTGCTCAGATGTCACCCTGAAGGAG
ACCACAGACTTCCTAGTCTCTCTGATGGTGCTCCTGGTCTCCTCTACAGTCATTTCTGTG
TCCTATGGCAACATCGTCTGGACGTTGCTGCACATCCGTTCGGCTGCTGAGCGCAGAAAG
GCTTTCTCCACTTGTGCAGCTCACCTGACAGTGGTGAGCCTCTTCTATGGCACTCTTTTC
TTTATGTATGTCCGGACCAAAGTGGCCTCCTCCATCAACTTCAACAAGGTAGTGTCTGTC
TTCTACTCCATTGTCACACCAATGCTCAACCCCCTCATCTACAGTCTTCGGAACAAGGAG
GTGAAGGGAGCTCTGGGCCGAGCCTTTTCCCTCAGGTCTTGGAAAGGTCAG


Conceptual translation

MQPYAQNWTHVTEFVMVGFAGVHEARLLFFTVFLTMYLFTLVENLAIILVVALNHRLHRP
MYFFLTHLSCLEIWYTSVTVPKMLAGFIGVDGGKNISYTGCLSQLFIFTFLGATECFLLA
AMAYDRYVAICMPLRYGALVSWGTCIRLAAACWLVGLLTPVLPIYLMSQLTFCGPNVIDH
FFCDVSPLLALSCSDVTLKETTDFLVSLMVLLVSSTVISVSYGNIVWTLLHIRSAAERRK
AFSTCAAHLTVVSLFYGTLFFMYVRTKVASSINFNKVVSVFYSIVTPMLNPLIYSLRNKE
VKGALGRAFSLRSWKGQ