Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6U3P Olfactory Receptor

Gene Symbol OR6U3P
Organism Dog
Family 6
Subfamily U
Pseudo Yes
Location chr10:37141-37848 (+)
Aliases cOR6U3

Sequence information


Nucleotide sequence

ATGCCCAAGATGTTGCTCAGCATTGCCACAGGGACCAAGACCATTAGTTTTGCTGGTTGC
ATCACTTAGGACTTTTTCCACGTCTTCCTGGAGGCTACAGAGTTCCTCCTCCTCACACCC
AAGGCCTGTGACCACTACATTGCCATCTGCCAGCCTCTCTGCTACCTCAGTGTCATGAGC
AACAGAGTCTGCACACGGCTCATCCTCACCTGCTGGCTGGCAGGATTCTCCTTCATCATC
GTGCCTGTCATCCTGACCAGTCATCTTCCATTATGCAACACCCACATCAACCACTTCTTC
TGTAACTATATGCCTCTAATGGAAGTAGTGTGTAGCAGGCCACAAGTGTTAGAGGTGGTG
GCTTTTACCCTGGCCATTGAGGCGCTGGTCAGCACTGTATTGCTGATCACCATATCTTAT
GTCCAGATCATCCAGACCATTGTAAGGATCCCCTCTGTCCAGGAGAGAAGGAAAGCTTTC
TCTACCTCTTCTTCCCATATCATTGTGATCACCAGGTGCTATGACAGCTGCTTCTTCATG
TATGTCAAGCCCTCTCTAGGCAAGGGGGTTGATTTCAACAAAGGAGTGTCTGTAATCAAT
ACAATTATTGCCCCCCTCTTGAATCCCTTCATCTATACTCTCAGGAACCAACAAGTTAAG
GAAGTAGTGAAAAACCTGATCAGGAAAATGGCTTGGATTCAAAATAAA


Conceptual translation

MPKMLLSIATGTKTISFAGCIT*DFFHVFLEATEFLLLTPKACDHYIAICQPLCYLSVMS
NRVCTRLILTCWLAGFSFIIVPVILTSHLPLCNTHINHFFCNYMPLMEVVCSRPQVLEVV
AFTLAIEALVSTVLLITISYVQIIQTIVRIPSVQERRKAFSTSSSHIIVITRCYDSCFFM
YVKPSLGKGVDFNKGVSVINTIIAPLLNPFIYTLRNQQVKEVVKNLIRKMAWIQNK