Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6V1 Olfactory Receptor

Gene Symbol OR6V1
Organism Dog
Family 6
Subfamily V
Pseudo No
Location chr16:6567626-6568645 (-)
Aliases cOR6V2

Sequence information


Nucleotide sequence

ATGGTCAATGACACCCTTTCTCTCTGTCTTACTATCTCTGTCTCTTGTTTCCTTTCTATG
CAGGGACCCAGCTCCTGGATCATGGCAAATCTGAGCCACCCTTCTGAATTTGTCCTCTTG
GGCTTCTCCTCTTTTGGCAAGCTTCAGGTTCTGCTGTATGGACCCTTACTCATGCTTTAT
CTTCTTGCCTTCGTGGGAAACACAGTCATCATAGTCATGGTCATAGCAAACACCCACCTA
CATACGCCCATGTACTTCTTTCTGGGTAACTTTTCACTGCTGGAGATCTTGGTAACCATG
ACAGCAGTGCCTAAGATGCTCTCAGACCTGCTGACTTCCCACAAAGTCATTTCCTTCAAT
GGCTGCATGGTCCAGTTCTACTTCTACTTTTCCCTGGGTTCCACCTCCTTCCTCATCCTG
TCAGACATGGCCCTTGACCGCTTTATGGCCATCTGCCACCCACTGCGCTATGGCACTTTG
ATGAGCTGGGCTGTGTGTGTCCGGCTGGCAGGAGTTGCCTGGGCAGCTCCTTTCCTGGCC
ATGGTGCCCACTGTCCTCTCCCGGGCTTATCTCAATTATTGCCATAACAACATCATTAAC
CACTTCTTCTGTGACAATGCACCTCTGCTACAGCTGTCCTGCTCAGACACCAGGCTGCTG
GAATTCTGGGACTTTGTGATGGCCTTGGCCTTTGTCCTCAGTTCCTTCCTAGTGACCCTC
ATCTCCTATGGCTATATTGTGACCACTGTGCTGAGGATCCCATCTGCTAGTGGCCGCCAT
AAGGCTTTCTCTACATGTGGGTCACATCTCACCCTTGTCTTCATTGGCTACAGCAGCACC
ATCTTCCTTTATGTCAGGCTTGGCAAAACACATTCTGTGGAAGTCAACAAGACCGTAGCC
TTGGTGACATCGGTCCTCACTCCCTTTCTCAATCCCTTTATCCTTACCTTCCGCAATGAG
ACAGTCAAGGCAGTGCTACAGGGGCAGATGCAGAGGCTTAAAGGCCTCCACAAGGGACTA


Conceptual translation

MVNDTLSLCLTISVSCFLSMQGPSSWIMANLSHPSEFVLLGFSSFGKLQVLLYGPLLMLY
LLAFVGNTVIIVMVIANTHLHTPMYFFLGNFSLLEILVTMTAVPKMLSDLLTSHKVISFN
GCMVQFYFYFSLGSTSFLILSDMALDRFMAICHPLRYGTLMSWAVCVRLAGVAWAAPFLA
MVPTVLSRAYLNYCHNNIINHFFCDNAPLLQLSCSDTRLLEFWDFVMALAFVLSSFLVTL
ISYGYIVTTVLRIPSASGRHKAFSTCGSHLTLVFIGYSSTIFLYVRLGKTHSVEVNKTVA
LVTSVLTPFLNPFILTFRNETVKAVLQGQMQRLKGLHKGL