Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR6X1 Olfactory Receptor

Gene Symbol OR6X1
Organism Dog
Family 6
Subfamily X
Pseudo No
Location chr5:10697727-10698713 (+)

Sequence information


Nucleotide sequence

ATGGTTCTAAGGACCTACTTTCTTGCTCGTCTTTCTAGACTATCGAGGGACATGAGAAAT
GGCACAACAATCACAGAGTTCATCCTGGTAGGCTTTCCTGATATCCAAGGACTACAAATC
CCTCTCTTTATAGTGATCTTTTTCATCTACATATTAACCCTTGTGGGCAATGGGCTCATA
ATTGTCATTGTGTGGGCAGAGCCCAGGCTACAAATACCAATGTACTTCTTCCTTTGCAAC
TTGTCCTTCCTAGAGACGTGGTACACCACCACAGTCATCCCCAAACTGTTGGAGACTTTT
GTGGTGGCAAGAGCAACCATTTCCATCCCCTGCTGTCTACTGCAGTCCTTCTTCCACTTT
TTCCTGGGTACCACTGAGTTCTTTATCCTCACCATCATGTCTTTTGACCGTTACCTGGCC
ATCTGCAAGCCCCTTCGCTACCCCACCATTATGACCAGCAACCTCTGCCTGCAACTTGCA
CTCAGCTCCTGGATGGTCGGCTTTACCATTGTCTTTTGTCAGATGCTTCTGCTCATCCAG
TTGCCATTCTGTGGCAACAATGTCATCAATCATTTCTACTGTGATGTTGGTCCCATTTTG
AAAGCAGCCTGCGTAGACACAAGCATTCTGGAGCTCCTGGGTCTTTTGGCGACCATCCTG
GTGATCCCAGGGTCACTCCTCTTCACAGTAATTTCTTATATCTATATCCTGTCCACCATC
CTACAGATCCCTTCAGCCACTGGCAGACAAAAGACTTTCTCTACCTGTGCCTCTCACCTG
ACGGTAGTCTCCCTGCTGTATGGTGCTGTCTTGTTCATGTACCTGAGACCCACAACACAC
TCTTCCTTTAAGATTAATAAGGTGGTGTCAGTGCTAAATACTATCCTCACACCCCTTCTG
AATCCCTTCATTTACACAATTAGAAACAAGGAGGTTAAAGCAGCCCTAAGGAAGACAATG
ACTTGTCCAAAGACTCATCATCCAGAG


Conceptual translation

MVLRTYFLARLSRLSRDMRNGTTITEFILVGFPDIQGLQIPLFIVIFFIYILTLVGNGLI
IVIVWAEPRLQIPMYFFLCNLSFLETWYTTTVIPKLLETFVVARATISIPCCLLQSFFHF
FLGTTEFFILTIMSFDRYLAICKPLRYPTIMTSNLCLQLALSSWMVGFTIVFCQMLLLIQ
LPFCGNNVINHFYCDVGPILKAACVDTSILELLGLLATILVIPGSLLFTVISYIYILSTI
LQIPSATGRQKTFSTCASHLTVVSLLYGAVLFMYLRPTTHSSFKINKVVSVLNTILTPLL
NPFIYTIRNKEVKAALRKTMTCPKTHHPE