Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR7A24P Olfactory Receptor

Gene Symbol OR7A24P
Organism Dog
Family 7
Subfamily A
Pseudo Yes
Location chr20:47773382-47774316 (-)

Sequence information


Nucleotide sequence

ATGGAATAAAGAAATCAAACCTATGTTTCAGAATTTTTCCTCCTGGAACTTTCAGAAGAG
AAGGAGCTACAGTCCTTGGTCTTTGGCTGCTCCTGTCCTTGTACCTGGTCACCTTCAGTG
GAAACCTGATCATCATCCTGGCTGTTGTAATGGACTCCCACCTCCACACTCCCATGTACT
TCTTTCTTACCAACCTGTCCTTTGTAGATGTCTGTTTCACCTCCACTACCATCCCCAAGA
TGCTTCAGAACACCCAGACTCAGAGCAAAGTCATCATCTATGCAGGCTGCATTGCACAGA
TTTATTTTCCCATAGTCTTTGCCATGTTGAATGTCTTTTTCCTGAGTGTGATGGTCTTTG
GCAGATGGCCATCTGCTGCCCCCAGCACTACATGGTCATCATGAATCATCTGCTCTGTGG
ACTGCTGGTTCTGGTGTTCTGGATCATGTGTATCCTGAACTCCTTGTTACAGTTTAATGA
TATTGTGGCTTTCTTTCTGTACATACTTCCAAATCCCCCACTTTTTCTGTGAACGCAATC
AGAAATTTGCTTGTTCTGACCCCCTTCTTAATAACTTGGTGATATATTTTGCAACTGTCT
TGTTAGCTGCTGGTCCCTTTATTGGGATCCTTTACTCTTATTCTAAGATCGTTTCCTCCA
TATGTGGAATATTGTCAGCTCAGGGCAAGTATAAAGCATTTTCCACCTGTGCATCTCACC
TCTCAGTTGTCTCCTTATTTAATTGTATGATACTTGTGTACCTTAGCTCTGCTGCTACCC
ACAGCTCACAGTCAAGTGCAATGGCCTTGGTGATGTATACGGTGGTCACACTCATGCCAA
ACCCCTTCATTTATAGCCTGAAGAACAGAGATATAAAGAGGGTTCTGAAAGCATTCTTTG
TGAGGGAAACTCCACCTGGCCAACTGTTAAAAGAC


Conceptual translation

ME*RNQTYVSEFFLLELSEEKELQSLVF/LLLSLYLVTFSGNLIIILAVVMDSHLHTPM
YFFLTNLSFVDVCFTSTTIPKMLQNTQTQSKVIIYAGCIAQIYFPIVFAMLNVFFLSVMV
F/QMAICCPQHYMVIMNHLLCGLLVLVFWIMCILNSLLQ\MILWLSFCTYFQIPHFFC
ERNQKFACSDPLLNNLVIYFATVLLAAGPFIGILYSYSKIVSSICGILSAQGKYKAFSTC
ASHLSVVSLFNCMILVYLSSAATHSSQSSAMALVMYTVVTLMPNPFIYSLKNRDIKRVLK
AFFVRETPPGQLLKD