Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR7A25P Olfactory Receptor

Gene Symbol OR7A25P
Organism Dog
Family 7
Subfamily A
Pseudo Yes
Location chr20:47413036-47413903 (+)

Sequence information


Nucleotide sequence

CAGTTTCTTCTTCTGGGATTATCAGAGGAACCAGAATTACAGCCCCTCCTATTTGGGATG
CTCCTCTCCATGTACCTGATCACTGTGCTTGGAAACCTGCTCATCATCCTGGTCATCAGC
ACAGATCCCAGCCTCCTCACCCCCGTGTACTTCTTCCTCACCAACCTCTCCTTTGTCAAC
ATCTGTTTCACCTCCACCACTGTCCTGAAGATGCTGCAGAATATCAAGACTCAGAGCAAG
GTAATCACCTATGTAGCCTGCATCACACAGATGTACTTTATAGTAATCTTTACAGTGTTG
GACATGGATCTTCTGGCCGTGATGACTTATGACCGACATGTGGCCATCTGTCACCCCTGC
ACTACATGGTCATCATGAACCCCTGGTTCTGTGTGTGGCTGGTTCTTGTGCCCTGGGTCA
TAGGTGTCTTGTATTTCTTGTTATAAACCTCAATGGTGTTGCAACTGTCCTTCTATAGAG
AGGTGGAAATCCCTCCCTTTTTCTGTGAACTCAGTCAGATGACCCAACTTGCCTTTTCTG
ACATCTTTCTTAGTAAAATGGTAACGTATTTTGTAGCTACGTTTCTGGGGTTGGTCCCCT
CACTGGGATAATTTACTTTTATTCTAAGATAATCTCCATATGTGGAATCTCATCAGCTCA
GGGCAAGTATAAAGCATTTTCCACCTGTGCTTCTCACCTCTTTGTTGTCTCCTTATTTTA
TTCTATGGACCTAGGAGTGTACCTTAGTTCTGCTGCTCCCCAGAGCTCCCACTCAAGTGC
AGTAGCCTCAGTGATGTATGTGGTGGTCAACCCCATGCTGAACCCCTTCATCTTCAGCCT
GAGTTTGTTTCTTATAGTTAAGTGTCTC


Conceptual translation

QFLLLGLSEEPELQPLLFGMLLSMYLITVLGNLLIILVISTDPSLLTPVYFFLTNLSFVN
ICFTSTTVLKMLQNIKTQSKVITYVACITQMYFIVIFTVLDMDLLAVMTYDRHVAIC/P
LHYMVIMNPWFCVWLVLVPWVIGVLYFLL*TSMVLQLSFYREVEIPPFFCELSQMTQLAF
SDIFLSKMVTYFVATFLGL/PLTGIIYFYSKIISICGISSAQGKYKAFSTCASHLFVVS
LFYSMDLGVYLSSAAPQSSHSSAVASVMYVVVNPMLNPFIFSLSLFLIVKCL