Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR7A60 Olfactory Receptor

Gene Symbol OR7A60
Organism Dog
Family 7
Subfamily A
Pseudo No
Location chr20:47602887-47603816 (+)
Aliases cOR7C55

Sequence information


Nucleotide sequence

ATGCAACCAGAAAATGATACATGGGTATCAGAATTCTTTCTTCTGGGATTATCAGAGGAA
CCAGAACTTCAGTCCATCATATTTGGGCTTTTCCTCTCCATGTACCTGATCACAGTCTTT
GGAAACCTGCTCATCATCCTGGCCATCAGCTCTGACTCCCATCTCCACACTCCCATGTAC
TTCTTTCTTGCCAACCTGTCCTTTGCTGACATCTGTGTCACCTCCACCACCGTCCCAAAG
ATGCTGCTGAACGTCCAGACTCAGAGCCAAGTCATCACCTATGCAGGTTGCATCACACAG
ATGCACTTTTTCATAATCTTCTCAGGGTTGGACATCTATCTCCTGGCTGTGATGGCCTAT
GACCGTTTTGTGGCCATCTGTCATCCCCTGCAGTACATGGTCATCATGAACCCCCGGCTC
TGTGGACTGTTGCTTTTGGTGTCCTGGATTACAAATGTCTTGCATTCCTTGTTACAGACC
TCAATTGTGTTGCAGCTGTCCTTCTGTAGAAAGGCAGAAATCTCCCACTTTTTTTGTGAA
CTCAATCAGATGATCCAACTTGCCTGTTCTGACAGCTTTCTCTATAACATGGTGATGTAT
TTTGTAGCTGTCCTGCTGGGTGGGGGCCCCCTCCCTGGTATCCTTTACTCTTATTCCAGG
ATAGTTTCCTCCATAGTTGGGATCTCATCAGCTCAGGGCAAGTATAAAGCATTTTCCACC
TGTGCATCTCACCTGTCAGTTGTCTCCTTATTTTTTTGTTCTGGTCTTGGAGTGTACCTC
AGCTCTGCTGCTCCCCAGAACTCCCACACGAGTGCAGTGGCCTCAGTGATGTACACAGTG
GTCACACCCATGCTGAACCCCTTCATCTACAGCCTGAGGAACAGAGACATAAAGAGGGCT
CTGAAAAGAGTCACTGGGGTTCCAGTGATG


Conceptual translation

MQPENDTWVSEFFLLGLSEEPELQSIIFGLFLSMYLITVFGNLLIILAISSDSHLHTPMY
FFLANLSFADICVTSTTVPKMLLNVQTQSQVITYAGCITQMHFFIIFSGLDIYLLAVMAY
DRFVAICHPLQYMVIMNPRLCGLLLLVSWITNVLHSLLQTSIVLQLSFCRKAEISHFFCE
LNQMIQLACSDSFLYNMVMYFVAVLLGGGPLPGILYSYSRIVSSIVGISSAQGKYKAFST
CASHLSVVSLFFCSGLGVYLSSAAPQNSHTSAVASVMYTVVTPMLNPFIYSLRNRDIKRA
LKRVTGVPVM