Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR7A61 Olfactory Receptor

Gene Symbol OR7A61
Organism Dog
Family 7
Subfamily A
Pseudo No
Location chr20:47186500-47187510 (-)
Aliases cOR7C41P

Sequence information


Nucleotide sequence

ATGAGTCATGTTATTTTCCCCTGTGCTGGTAGTCGCCTCCACCATATGGACCCAGGAAAT
TATACAGGAATTTCAGAATTCTACCTTATGGGATTTTCAGAAGAACTAGAACTACAGCCC
CTTGTATTTGGGCTTTTCCTCTCCATGTACCTGGTCACTGTGTTTGGAAACCTGCTCATC
ATCCTGGCCGTCAGCTCTGACCCCCACCTCCACACCCCTATGTACTTCTTCCTCACCAAC
CTGTCCTTTGTAGACATCTGTTTCACCTCCACCACCGTTCCCAAGATGCTGCAGAACATC
CAGACCCAAAGCAAAGTCATCACCTATGCAAGGTGCCTCACACAGATGTACTTTTTCATA
CTGTTTACAGGATTAGACATCTTTCTTCTAACTGTGATGGCTTATGACCGGTTTGTAGCC
ATCTGTCACCCCCTGCGCTACACGGTGATCATGAACCCCTGGCTTTGTGCACTGCTGGTT
CTGGTGTCCTGGGTCGTGAGTGTCCTGTATTCCTTGTTACAAACCTCCATGGTGTTGCAG
CTCTCCTTCTGTACAGAGGTGGAAATCCCCCACTTTTTCTGTGAACTGAATCAGATGATA
CAACTTGCCTGCTCTGACACCTTTCTCAACAACATGGTGATGTATCTTGCAACTGTGCTT
CTGGCTGGTGGTCCCTTCTTTGGGATCCTTTACTCTTACTCTCAGATTGTTTCCTCCATA
CATAGAATCTCATCAGCTCAGGGCAAGTATAAAGCATTTTCCACCTGTGCATCTCACCTC
TCGGTTGTCTCCTTATTTTACTGTACGGGCCTAGGAGTGTACCTTAGCTCTGCTGCTACC
CAGAGCTCCCACTCAAGTGCAGTGGCCTCAGTGATATACACAGTGGTCACGCCCATGCTG
AATCCCTTCATCTACAGCCTGCGGAACAGAGACATAAAGGAGGCTCTGATGAGATTCTCT
GGGATGCCAGCTCTAAAGGGACCAATCGTCCTGGGGCTGAAGAAGTGCCCA


Conceptual translation

MSHVIFPCAGSRLHHMDPGNYTGISEFYLMGFSEELELQPLVFGLFLSMYLVTVFGNLLI
ILAVSSDPHLHTPMYFFLTNLSFVDICFTSTTVPKMLQNIQTQSKVITYARCLTQMYFFI
LFTGLDIFLLTVMAYDRFVAICHPLRYTVIMNPWLCALLVLVSWVVSVLYSLLQTSMVLQ
LSFCTEVEIPHFFCELNQMIQLACSDTFLNNMVMYLATVLLAGGPFFGILYSYSQIVSSI
HRISSAQGKYKAFSTCASHLSVVSLFYCTGLGVYLSSAATQSSHSSAVASVIYTVVTPML
NPFIYSLRNRDIKEALMRFSGMPALKGPIVLGLKKCP