Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR7A67 Olfactory Receptor

Gene Symbol OR7A67
Organism Dog
Family 7
Subfamily A
Pseudo No
Location chr20:47455639-47456568 (+)
Aliases cOR7C38

Sequence information


Nucleotide sequence

ATGGAATCAGACAACGATACACGAATTTCAGAGTTCCTTCTTCTGGGATTCTCAGGGGAA
TCAGAACTGCAGCCCCTCATATTTGGGCTTTTCCTCTCCATGTACCTCATCACTGTGTTT
GGAAACTTGCTAATCATCCTGGCTGTCAGCTCTGACTCCCACCTCCACACCCCCATGTAC
TTCTTCCTCACCAACCTGTCCTTTGTAGACATCTGTTTCATCTCCACTACTGTCCCCAAG
ATGCTCCAGAACATTCAGACTGGAAGTAAAGTCATAACCTACCCAGGCTGCATCACACAG
ATATACTTTTTCCTACTCTTTGCAGGATGTGATGATTTTCTCCTGAGTATGATGGCCTAT
GACCGCTTTGTGGCCATCTGCCATCCCCTGCACTACACAGTCATCATGAACCCCTGGTTC
TGTGTACTGCTTGTTCTGGTGGCCTGGATCACCAGTGTTCTCAATTCCTTGTTACAGAGC
TTAATGGTGTTACAGCTGTCCTTCTGTGCAGGCATGGAAATCCCCCATTTTTTCTGTGAC
CTCAATCAGGTAATTGGGCACGCCTGTTCTGACAGATTTCTTAATGAGGTGGTGATGTAT
TTTGCAACTGTGCTGCTGGGTGTGGCTCCCTTGCCTGGGATCCTTTTCTCTTACTCTAAG
ATAGTTTCCTCCATATGTGGAATATCATCGATTCAGGGTAAGTATAAAGCATTTTCCACC
TGTGCATCTCACCTCTCAGTTGTCTCCTTATTTTACTGTACAGGCTTAGGAGTATACCTT
AGCTCTGCTGTGCCCCAAGGCTCCCATGCAAGTGTAGTGGCCTCGGTGATGTACACAGTG
GTCACGCCCATGCTGAACCCCTTCATCTACAGCCTGAGGAACAGAGATATAAAGAGGGCT
CTGAAAAGAATCATTGGGGTTCCTGTGATG


Conceptual translation

MESDNDTRISEFLLLGFSGESELQPLIFGLFLSMYLITVFGNLLIILAVSSDSHLHTPMY
FFLTNLSFVDICFISTTVPKMLQNIQTGSKVITYPGCITQIYFFLLFAGCDDFLLSMMAY
DRFVAICHPLHYTVIMNPWFCVLLVLVAWITSVLNSLLQSLMVLQLSFCAGMEIPHFFCD
LNQVIGHACSDRFLNEVVMYFATVLLGVAPLPGILFSYSKIVSSICGISSIQGKYKAFST
CASHLSVVSLFYCTGLGVYLSSAVPQGSHASVVASVMYTVVTPMLNPFIYSLRNRDIKRA
LKRIIGVPVM