Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR7A72P Olfactory Receptor

Gene Symbol OR7A72P
Organism Dog
Family 7
Subfamily A
Pseudo Yes
Location chr20:47748649-47749582 (-)
Aliases cOR7C8P

Sequence information


Nucleotide sequence

ATGGAACCAGAAAATCAAACATGTGTTTCAGAATTTATCCTCCTGGGGCTCTCAGAAGAG
GTATTACTACAGTCCCTCCTTTTTGGATTTTTTTCTGTCCATGTACCTGGTAACTTTCAT
TGGGAACCTACTCATCATCCTGGCAATTATCACTGACTCCTGCCTCCACACGCCCATGTA
CCTCTTCCTCTCTAATCTCTCTTTTGCAGACATCTGTTTCACCTCCACCACAGTCCCCAA
AATGCTGTTGAATATCCAGACACAGAGAAAATTCATTACCTATGCAGAATATATCACCCA
GGTATATTTCTTCATGCTTTTTGGAGATCTGGATAACTTCCTTCTGACGGTGATGGCTTA
TGACCGGTTTGTGGCCATCTGTCACCCCCTACAATATATGGTCATGATGAACCCTTGGGT
CTGTGGGCTCCTGCTTATGGCATGCTGAATTATGACTGCCCTGCAGTCATTGTCACAGAG
CTTAATGGTTTTACGGCTCTCTTTTTGTAATGATTTGGAAATCCCTCACTTTTTCTGTGA
ACTTAATCAATTGGTCCAACTTGCTTGTTCTGACACCTTTCTCAATGATATAGTTATGTA
TTTTGCTACTGGACTTGTTGGTGTTGTTCCTCTTACTGGAATTCTCTTCTCTTACTCTAA
GATTGTAACCTCCATTTTGAGAATTTCATCAGCTGGAGGCAAGTATAGAGCATTTTCCAC
ATGTGGGTCTCACCTTTCAGTTGTCTCCTTGTTCTACTGCACAGGCCTTGGGGTCTACCT
CAGTTCTACTGGTTCACAAAACTCCAGGACAAGTGCCATAGCCTCAGTGATGTATACAGT
GGTCACACCCATGCTGAACCCCTTTATTTACAGTCTTAAAAACAAAGACATAAAGCAATC
ACTTAAAAAACTCTTCAGCCAAAAAACATTCTGT


Conceptual translation

MEPENQTCVSEFILLGLSEEVLLQSLLFGFF\SMYLVTFIGNLLIILAIITDSCLHTPM
YLFLSNLSFADICFTSTTVPKMLLNIQTQRKFITYAEYITQVYFFMLFGDLDNFLLTVMA
YDRFVAICHPLQYMVMMNPWVCGLLLMAC*IMTALQSLSQSLMVLRLSFCNDLEIPHFFC
ELNQLVQLACSDTFLNDIVMYFATGLVGVVPLTGILFSYSKIVTSILRISSAGGKYRAFS
TCGSHLSVVSLFYCTGLGVYLSSTGSQNSRTSAIASVMYTVVTPMLNPFIYSLKNKDIKQ
SLKKLFSQKTFC