Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR7A73 Olfactory Receptor

Gene Symbol OR7A73
Organism Dog
Family 7
Subfamily A
Pseudo No
Location chr20:47782881-47783798 (-)
Aliases cOR7C7

Sequence information


Nucleotide sequence

ATGGAACAAAGAAATCAAAGCCGCGTTTCACAATTTATCCTCCTGGGACTTTCAGAGGTG
GGAGAACTACAGCCACTGCTCTTTTGGCTGTTCTTTTCCATGTACCTGATCACCTTCAGT
GGGAACCTGCTCATCATCCTGGCCATTGTCATGGACTCCCACCTCCACACACCCATGTAC
TTCTTCCTCTCCAACCTGTCCTTTGTAGACATCTGTTTCACCTCTACCACCGTCCCCAAG
ATGCTGCTGAACATCCAGACACAGAGCAAAGTGATCACCTATGAAGGCTGCCTCAGCCAG
ATGTATTTTTTCATGCTGTTTGGAGGATTAGACAACTTTCTCTTGACAGTGATGGCCTAT
GACCGGTTTGTGGCCATCTGTCACCCCCTGTACTACATGGTCATCATGAATCCCAAGTTC
TGTGGCATCCTGCTTCTGGCATGCTGGTTATTGAGTGTTATGGACTCTCTATTACATGAC
TTAATGGTTTTCCAATTGTCTTTCTGTACACAGTTAGAAATCTCTCACTTTTTCTGTGAA
CTTAAACAGATGATCCAACTTGCTTGCTCTGATACCTTCCTCAATAACCTGGCAATTTAT
CTTGCAAGTGGACTTCTGGGGGTTCTTCCACTCATTGGTATCCTTTTCTCTTATTCTAGA
ATTGTAGCTTCCATTTTGAAAATTTCATCTTCTGGGGGCCAGTATAAAGCATTTTCCACA
TGTGGGTCTCACCTTTCAGTCGTTTCCTTATTCTATGGTACAGGATTTGGAGTGTATCTT
AGTTCTACTGCTTTGCGAAACTCCAGAGCAAGTGCCATAGCCTCGGTGATGTACACAGTG
GTCACTCCCATGCTGAACCCCTTTATCTATGGTCTGAGGAACAGAGACTTAAAGCAGGCC
TTAAGAAAACTCTTTAGC


Conceptual translation

MEQRNQSRVSQFILLGLSEVGELQPLLFWLFFSMYLITFSGNLLIILAIVMDSHLHTPMY
FFLSNLSFVDICFTSTTVPKMLLNIQTQSKVITYEGCLSQMYFFMLFGGLDNFLLTVMAY
DRFVAICHPLYYMVIMNPKFCGILLLACWLLSVMDSLLHDLMVFQLSFCTQLEISHFFCE
LKQMIQLACSDTFLNNLAIYLASGLLGVLPLIGILFSYSRIVASILKISSSGGQYKAFST
CGSHLSVVSLFYGTGFGVYLSSTALRNSRASAIASVMYTVVTPMLNPFIYGLRNRDLKQA
LRKLFS