Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR7A74 Olfactory Receptor

Gene Symbol OR7A74
Organism Dog
Family 7
Subfamily A
Pseudo No
Location chr20:47500000-47501016 (-)
Aliases cOR71

Sequence information


Nucleotide sequence

ATGCAAAATATTAACAATAATGTATCTTCCAGGTTAGTAATGCATGATTGTGTCATGTTT
TTCTCTTATTTTGGTAGTCTTGTCCACTACATGGAACTAGAGAATGATACACGAATTCCA
GAATTTCTCCTTCTGGGATTTTCAGAGGAACCAAAATTGCAGCCCTTCCTCTTTGGGCTG
TTCCTGTCCATGTACCTGGTCACCATACTTGGGAACCTGCTCCTCATCCTGGCTGTCAGC
TCTGACTCTCACCTCCACACCCCCATGTACTTCTTCCTTGCCAATCTGTCCTTTGTAGAC
ATCTGTTTCACCTGTACCACCATCCCAAAGATGCTGGTAAATATACAAACACAAAGAAAA
GTCATAACTTATGAGAGCTGCATCATACAGATGTACTTTTTCATACTTTTTGCAGGTATA
GACAATTTCCTCCTGACTGTGATGGCCTATGATCGCTACATGGCCATCTGCTACCCCCTG
CACTACATGGTCATCATGAACCCTCAGCTCTGTTCACTACTACTACTGGTATCCTGGATC
ATGAGTGCCTTGCATTCTTTGTTACAAACCTTAATGGTGTTGCGACTGTCCTTCTGTACA
CATTTCCAAATCCCCCACTTTTTCTGTGAACTCAATCAGATGATCCAACTTGCCTGTTCT
GACACCTTTCTTAATAACATGATGTTGTATTTTGCAGCTATATTGCTGGGGGTTGCTCCC
CTGGTTGGAGTCCTTTACTCTTATTTCAAGATAGTTTCCTCTATACGTGGGATCTCATCA
GCTCACAGCAAGTATAAAGCATTTTCCACCTGTGCTTCTCACCTCTCGGTTGTCTCCTTA
TTTTATTGTACAAGCCTAGGAGTGTACCTTAGCTCCGCTGCTCCCCAGAGCACCCACACA
AGTTCAGTGGCCTCAGTGATGTACACAGTGGTCACCCCCATGCTGAACCCCTTCATCTAC
AGCCTCAGGAACAAAGACATAAAGGGAGCTCTAAATGTATTTTTCAGAGGGAAGCCA


Conceptual translation

MQNINNNVSSRLVMHDCVMFFSYFGSLVHYMELENDTRIPEFLLLGFSEEPKLQPFLFGL
FLSMYLVTILGNLLLILAVSSDSHLHTPMYFFLANLSFVDICFTCTTIPKMLVNIQTQRK
VITYESCIIQMYFFILFAGIDNFLLTVMAYDRYMAICYPLHYMVIMNPQLCSLLLLVSWI
MSALHSLLQTLMVLRLSFCTHFQIPHFFCELNQMIQLACSDTFLNNMMLYFAAILLGVAP
LVGVLYSYFKIVSSIRGISSAHSKYKAFSTCASHLSVVSLFYCTSLGVYLSSAAPQSTHT
SSVASVMYTVVTPMLNPFIYSLRNKDIKGALNVFFRGKP