Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR7C2 Olfactory Receptor

Gene Symbol OR7C2
Organism Dog
Family 7
Subfamily C
Pseudo No
Location chr20:47145624-47146610 (-)
Aliases cOR7H6P

Sequence information


Nucleotide sequence

ATGGAAAGAGGAAACCAAACAGGAGTTGGAAACTTTCTCCTCCTGGGATTCACAGAGGAA
CTGGACCTACAGCCTTTCTTCTTTGGGTTGTTCCTGTCCATGTATCTGGTCACATTCACT
GGGAATCTGCTCATCATCCTGGCCATCTGCTTAGACTCCCATCTCCACACACCCATGTAT
TTCTTCCTTGCCAACCTGTCCTCTGCTGACATCTGTTTCACCTCTACCACCGTCCCTAAG
ATGCTGCTGAACATCCAGACTCAGAGCAAAACCATAACATATGAAGGATGCCTCAGCCAG
ATTTTTTTTTTCATTGTATTTGGATGCCTGGACAATTTACTCCTGACCGTAATGGCCTAT
GACCGCTTTGTGGCTATCTGTCACCCCCTGCATTACACAGTCATCATGAACCCCCAGCTC
TGTGAACTGCTCGTCTTGGGGTCCTGGTGCATCAGTGTAACAGGCTCCCTTCTTGAGACC
TTGACCCTTTTGAGGCTGTCCTTCTGCACAAACATGGAAATCCCACACTTTTTTTGTGAT
CTTCCTGAAGTCCTGAAGCTCGCCTGTTCTGACATCCTCATCAATAACATAGTGGTGTAT
TTTGTGACTATTGTCCTAGGTGTTTTTCCTCTCTCTGGAACCCTCTTTTCTTATTCTGAG
ATTTTTTCCTCCATCCTGAGAATTTCATCAGCCAGGGGCAAATATAAAGCCTTTTCCACG
TGTGGGTCTCACCTCTTGGTGGTCTCCCTGTTCTATGGCACAGGCCTTGGGGTCTACCTC
AGTTCTGCAGTGACTTCATTCTCTAAGATGAGTTTGATGGCCTCGGTGATGTACACCATT
GTCACCCCTATGCTGAACCCCTTCATCTACAGCTTGAAGAACAGGGACATGAAGGGGGCC
CTGGGCAGGCTCCTCAGCAGGGTAGTACCTGTCAGCATCAGGACTCTCATGAGTAGCTGG
GGACACAATAATGAAGATGAGAAATCT


Conceptual translation

MERGNQTGVGNFLLLGFTEELDLQPFFFGLFLSMYLVTFTGNLLIILAICLDSHLHTPMY
FFLANLSSADICFTSTTVPKMLLNIQTQSKTITYEGCLSQIFFFIVFGCLDNLLLTVMAY
DRFVAICHPLHYTVIMNPQLCELLVLGSWCISVTGSLLETLTLLRLSFCTNMEIPHFFCD
LPEVLKLACSDILINNIVVYFVTIVLGVFPLSGTLFSYSEIFSSILRISSARGKYKAFST
CGSHLLVVSLFYGTGLGVYLSSAVTSFSKMSLMASVMYTIVTPMLNPFIYSLKNRDMKGA
LGRLLSRVVPVSIRTLMSSWGHNNEDEKS