Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR7G14 Olfactory Receptor

Gene Symbol OR7G14
Organism Dog
Family 7
Subfamily G
Pseudo No
Location chr20:51612498-51613448 (+)
Aliases cOR7G14

Sequence information


Nucleotide sequence

ATGGGACTCAGAAACAACACAGGGGTTTCAGAATTCCTTCTAATGGAAGTGACAGAGGAT
CCAGAACTGAAGCCCCTCCTCTTTGTTCTGTTCCTGTCCATATACCTGGTCACCATCCTG
GGAAACCTGCTCATCATCCTGGCTGTCATCTGTGACTCCCACCTCCACACCCCCATGTAC
TTCTTCCTGTCCAACTTGTCCTTTACTGACATCTGTTTAAGCACAACCACCATCCCAAAG
ATGCTGGTGAACATCCAAGCAGAGGATCAGAGCATCACTTACACAGGCTGCCTCACACAG
ATCTACTTTATCCTGGTTTTTGCTAGTTTGGAAAGTTTTCTTCTTTCAGTAATGGCCTAT
GACCGCTATGTGGCCATCTGTCATCCACTGAGGTACACGGTCATCATGAACTCCCACCTT
TGTGGCCTCTTAATTCTACTCTCTTTGTGCATTAACATTGTGGATGCCCTGATGCACAGT
CTGATGGTGTTGCAACTGTCCTTCTGCACAGACCTTGAAATCCCTCTCTTCTTCTGTGAA
GTTGTTCAGGTCATCAAGATTGCATGTTCTGACACCCTCATCAATAACATCCTGATATAT
TTTGCAACTAGCGTATTTGGTGGTATCCCTGTGTGTGGAATCATTTTCTCCTATACTCAG
ATAGTGTCTTCTGTTTTGAGAATGCCATCAACAGGTGGAAAGTATAAAGTTTTTTCCACC
TGTGGGTCTCACCTCTCTGTTGTGTCCTTGTTCTATGGAAATGGTTTGGGGGTGTACATT
AGTTCTGCTCTTACTAGCTCTTCCAGAAACACTGCGGTGGTTTCAGTGATGTACACTATT
GTCCCCCAAATGATGAACCCCTTCATCTACAGCCTGAGGAACAGGGACATGAAAGGAGCC
TTGAGGAAACTCATGAGTAAGATACCATTGTTTTTTCAGGAACGTGCTGTT


Conceptual translation

MGLRNNTGVSEFLLMEVTEDPELKPLLFVLFLSIYLVTILGNLLIILAVICDSHLHTPMY
FFLSNLSFTDICLSTTTIPKMLVNIQAEDQSITYTGCLTQIYFILVFASLESFLLSVMAY
DRYVAICHPLRYTVIMNSHLCGLLILLSLCINIVDALMHSLMVLQLSFCTDLEIPLFFCE
VVQVIKIACSDTLINNILIYFATSVFGGIPVCGIIFSYTQIVSSVLRMPSTGGKYKVFST
CGSHLSVVSLFYGNGLGVYISSALTSSSRNTAVVSVMYTIVPQMMNPFIYSLRNRDMKGA
LRKLMSKIPLFFQERAV