Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR7G5 Olfactory Receptor

Gene Symbol OR7G5
Organism Dog
Family 7
Subfamily G
Pseudo No
Location chr20:51579655-51580686 (+)
Aliases cOR7G5

Sequence information


Nucleotide sequence

ATGGTGCTTGTGCTTGGTGATATTCTTGCTACTTGCCCAGGAGCCAACATTTCATTGTCT
TGTTACCATATAATTTCCATCAGATTCATCAACAACATGGAACCTAGAAATGAAACAGTC
ATTATAGAATTTCTTCTCATGGAAGTGACAGATAATCCAGAACTGCAGTCCCTCATCTTC
ATCCTGTTCCTATTCATGTACCTGGTCACTGTCCTGGGAAACCTGCTCATCATCCTGGCT
GTCATCTCTGACTCCCATCTTCATATCCCCATGTACTTCTTTCTTTTTATTCTGTCATTT
ACTGACATCTGTTTAAGTACAACCACAATCCCAAAGATACTGGTGAATATCCATACACAG
AACCAGAGCATCACTTATGCAGGCTGCCTCACACAGATCTGCTTTGTCATGGTTTTTGCA
AGTTTGGATAGTTGTATTCTTTCAGTAATGGCCTATGATCGCTATGTGGCCATCTGTCAT
CCACTGAGGTACACAGTCATCATGAACTCCCACCTCTGTGGCCTCTTGATTCTTCTCTCC
CTGTTTATTAGCATTGTGGATGCCTTGATACACAATCTGATGGTGTTGCATCTGTCCTTC
TGCACAGAACTCGAAATCCCTCTCTTCTTCTGTGAAGTTATTCAGGTTATCAAGATCGCA
TGTTCTGACACCCTCATCAATAACATCCTGATATATTTTGCAACCAGCATATTTGGTGGT
ATTCCTCTGTGTGGAATCATTTTCTCTTACACTCAGGTAGTGTCTTCAGTTTTGAGAATG
TCATCAGCAGGTACAAAGTATAAAGCTTTTTCTACCTGTGGGTCTCACCTGTCAGTTGTG
TCTTTGTTCTATGGGACAGCTTTTGGGGTGTACATTAGTTCTGCTCTCACTAGCTCTTCC
AGAAACACTGCAGTGGTTTCAATGATGTACACTGTTGTCCCTCAAATGATGAACCCCTTC
ATCTACAGCCTGAGGAACAGGGACATGAAGGGAGCCTTGAGGAAACTCATAAGTAGAATG
CCTTCTCTTCTG


Conceptual translation

MVLVLGDILATCPGANISLSCYHIISIRFINNMEPRNETVIIEFLLMEVTDNPELQSLIF
ILFLFMYLVTVLGNLLIILAVISDSHLHIPMYFFLFILSFTDICLSTTTIPKILVNIHTQ
NQSITYAGCLTQICFVMVFASLDSCILSVMAYDRYVAICHPLRYTVIMNSHLCGLLILLS
LFISIVDALIHNLMVLHLSFCTELEIPLFFCEVIQVIKIACSDTLINNILIYFATSIFGG
IPLCGIIFSYTQVVSSVLRMSSAGTKYKAFSTCGSHLSVVSLFYGTAFGVYISSALTSSS
RNTAVVSMMYTVVPQMMNPFIYSLRNRDMKGALRKLISRMPSLL