Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR7T1P Olfactory Receptor

Gene Symbol OR7T1P
Organism Dog
Family 7
Subfamily T
Pseudo Yes
Location chr20:47532183-47532759 (-)

Sequence information


Nucleotide sequence

TTGGCCTATGACCATTTTGTGGCCATTTGCCACCCCCTGCATGGTCATCATGAAACCCAC
CTACTGTGTACTGTTGGTTCTGGTGGTCTGGATGATAAGTATCCTGAATTCCTTATTACA
AAGCTTAATGGTGTTGTGACTGTCCTTCTGTAGAGAGGTGGAAATTTCCAACTTTTTCTG
TGATGTCAAACAAGTGGTTCAACTTGCCTATTCTGACCTTTCTTAATGACATGGTGATGT
ATTTAACAGCTGTGCTGCTGGGTGGTGTCCCCTCACTGGGATCATTTATTTTTACTCTAA
GATAGTTTCCTCCATACTTGGGATCTCATCATCTCAGGGCAAGTATAAAGCATTTTCCAC
CTGTGCATCTCACCTCTCCATTGTGTTCTTATTGTATTGTACAATCCTGTACCTTAGCTC
TGCTGCTCCCAAAAGCTCCCTTTCAAGTGCTGTAGCCTCGGTGATGTACACAGTGGTCAT
ACCCATGCTGAACCCCTTCATCTATAGCCTGAGGAACAGAGATATAAAGAGAGATCTGAG
TTGTAGGGGTTCCAGTGATGTAAGGACCAGTCATCCT


Conceptual translation

LAYDHFVAICHPLH\IMKPTYCVLLVLVVWMISILNSLLQSLMVL*LSFCREVEISNFF
CDVKQVVQLAYSD\LNDMVMYLTAVLLG/CPLTGIIYFYSKIVSSILGISSSQGKYKA
FSTCASHLSIVFLLYCTILYLSSAAPKSSLSSAVASVMYTVVIPMLNPFIYSLRNRDIKR
DLSCRGSSDVRTSHP