Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR7U1P Olfactory Receptor

Gene Symbol OR7U1P
Organism Dog
Family 7
Subfamily U
Pseudo Yes
Location chr20:47331950-47333093 (-)

Sequence information


Nucleotide sequence

AACAATACACAAATTTCAGAGTTTTTTCTTCTGGGATTCAGAGGAACCAGAACTTCAGCC
CCTCATTTTTAGCCTTTTCCTTTCCATGTGCCTGATCACTGTAATTGGGAACCTGCTCAT
TATCCTGGCTGTGAGCTCTGACCCCCACCTCCACACCCCCAATACTCCTTCCTCACCAAC
CTGTCCTTTGTAGACATCTGTTCTACCTCCATCACCATCCTAAAGATGCTAATGAATATA
CAGAGAGCAAAGTCATAACCTATGCAGGTTGCCTCACACAGATTTATTTTTTCATACTGT
TTTCATATGAAACTTTCATACTGAAAGAAAGGATGTCTTTCTCCTGAGTGTGATGGCCTA
TGACAGGTATGTGGCCATCTGCCACCCCCTGCACTACACAGTCATCATGAGCCCCCAGCT
CTGTGGACTGCTGGTTCTGGTGTCCTGGATCATATGTATCCTCAATTCCTTGTTACAAAG
TTTTTTTTTTAATTTTTATTTATTCATGATAGGCACACAGTGAGAGAAAGAGAGGCAGAG
ACACAGGCAGAGGGAGAAGCAGGCTCCATGCACCGGGGGCCCGACGTGGGATTCGATCCC
GGATCTCCAGGATCGCGCCTTGGGCCAAAGGCAGGGGCCAAACCGCTGCGCCACCCAGGG
ATCCCCCTTGTTACAAAGTTTAATGATGTTGTGGCTTTCCTTCTGTACACAGGTGGAAAT
CCCTCACTTTTTCTGTGAACTCAATGAGATAGTCCAACTTGCCTGTACTGACACCTTTCT
TAATAACTTGGTGATGTATTTTGCAGCTGTCCTGCTGGGTGGAAGTCCTTTTGCTGGGAT
CATTCACTCTTATTCTAAGACTGTTTCCTCCATACATGGAATTTCATCAGCTCGGGGCAA
GTATAAAGCATTTTCCACCTGTGCGTCTCACCTCTCAGTTGTCTCCTTATTTTATTGTAC
AATGCTTGGTGTATACCTTAGCTCTGCTGCTACCCAGAGCTCCCACGCAAGTGCAGTAGC
CTCGGTGATGTACACCGTGGTCACACCCATGCTGAACCCCTTCATCTACAGCCTGAGAAA
CAAAGACATAAAGAGAGTTCTGAAAGCATTCTTTGCGAAGGAAACTCTATATGGCCAATT
GTGG


Conceptual translation

NNTQISEFFLLGF\EPELQPLIFSLFLSMCLITVIGNLLIILAVSSDPHLHTP/YSFL
TNLSFVDICSTSITILKMLMNIQR/KVITYAGCLTQIYFFILFSYETFILK/KDVFLL
SVMAYDRYVAICHPLHYTVIMSPQLCGLLVLVSWIICILNSLLQSFFFNFYLFMIGTQ*E
KERQRHRQREKQAPCTGGPTWDSIPDLQDRALGQRQGPNRCATQGSPLLQSLMMLWLSFC
TQVEIPHFFCELNEIVQLACTDTFLNNLVMYFAAVLLGGSPFAGIIHSYSKTVSSIHGIS
SARGKYKAFSTCASHLSVVSLFYCTMLGVYLSSAATQSSHASAVASVMYTVVTPMLNPFI
YSLRNKDIKRVLKAFFAKETLYGQLW