Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8B1N Olfactory Receptor

Gene Symbol OR8B1N
Organism Dog
Family 8
Subfamily B
Pseudo No
Location chr5:10130180-10131109 (+)
Aliases cOR8B20

Sequence information


Nucleotide sequence

ATGGCTCTCAGAAATGCTTCTTTTGTGACTGAATTCATTCTGGCAGGCCTCACAGACCTA
CCAGATCTCCAGCTCCCCCTTTTCTGCTTGTTTCTACTCATGTATGTGGTCACTGTGTTG
GGAAATTTGGGCTTGATCATTCTCATCAGGCTGAATTCACACCTCCACACCCCCATGTAC
TTTTTCCTCTTCAATTTGTCCTGCATAGACCTCTGTTATTCTTCTGTGTTTACACCCAAA
ATGCTGATTAACTTCACATCCAAGAAGAATATTATTTCCTACAGGGGGTGCATGACCCAA
CTTTACTTTTTTTGTTTTTTTGCTATTTCTGAATGCTATGTGCTGACATCCATGGCCTAT
GATCGCTATGTGGCCATCTGTAACCCACTTTTGTATAATGTTGTCATGTCTTCTAAAGTG
TGTTTCAGTCTTATGCTTGGTTCATATTTGATGGCATTTTTAGGTGCCATGGCTCACACG
GGATACATGGTGAGACTGACCTTCTGTAATGCAAACACCATCAACCATTATTTTTGTGAC
ATCCTCCCTCTATTCCAGCTCTCCTGCACCAGCACGTATGTGAATGAGCTGGTGGTTTTC
ATTGTGGGGAGCATCGACATCATTATGCCCTGTGTCACCATCTTTGTGTCTTATGGTTTC
ATCCTTTCCAGCATCCTGCGCATCAGCTCCACTGAAGGCAGGTCCAAAGCTTTCAGCACT
TGCAGTTCCCACATAATTGCTGTTTCCTTGTTTTTTGGATCATGTGCATTTATGTATCTT
AAACCATCTTCTGCTGGGTCTATGGATGAGGGGAAAATCTCTTCTATCTTTTACACCAAC
ACAGTTCCCTTGATGAACCCTTTAATTTACACCTTGAGAAACAAAGATGTTAAGCTTGCC
TTGAGGAAAATCCTGAGTAGGAGACAGTTT


Conceptual translation

MALRNASFVTEFILAGLTDLPDLQLPLFCLFLLMYVVTVLGNLGLIILIRLNSHLHTPMY
FFLFNLSCIDLCYSSVFTPKMLINFTSKKNIISYRGCMTQLYFFCFFAISECYVLTSMAY
DRYVAICNPLLYNVVMSSKVCFSLMLGSYLMAFLGAMAHTGYMVRLTFCNANTINHYFCD
ILPLFQLSCTSTYVNELVVFIVGSIDIIMPCVTIFVSYGFILSSILRISSTEGRSKAFST
CSSHIIAVSLFFGSCAFMYLKPSSAGSMDEGKISSIFYTNTVPLMNPLIYTLRNKDVKLA
LRKILSRRQF