Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8BJ2 Olfactory Receptor

Gene Symbol OR8BJ2
Organism Dog
Family 8
Subfamily BJ
Pseudo No
Location chr27:6313247-6314155 (+)
Aliases cOR8S18

Sequence information


Nucleotide sequence

ATGAACAACTTCACTTTCTTCACTGAGTTCATCCTCCTTGGGCTGTCTGCTGACTGCCAC
GTCCAGACTCTGCTCTTTGTGCTGTTTCTGGGAATTTACCTCCTGACTCTGATGGGGAAT
CTGGTGATGATCCTCGTGATCAGGGGGGATTCTCACCTCCATATCCCCATGTATTTTTTC
CTTGGACACCTGTCCTTCCTAGATATCTGCTTCTCCTCAGTTACTATGCCCAAAATGCTG
CAGAACTTCCTGTCTGAGAAGAAAAGCATCTCGGTCTGGGGCTGCATCACCCAGAGTTTC
TTTTTTCTTCTCTCTGGGTGTGCTGAAGCCAGTCTTCTCTCTGCCATGGCCTATGACCGC
TATGCTGCTGTCTGCTACCCTCTGCTCTATACCATGGTCATGAACAGATCTCTTTGCATA
GTAATGGTTAGTGCAGCATGGGTGATGGGGTTTCTGAACTCACTAGTGAATAATCTTTTC
ATCCACAAGTTACATTTTTGTGGGTCCAATGTCATCTCCCACTTCTGCTGCGAGCTACCC
TCACTCTTCCCTCTGTCATGTACTGATCCCACTGCCAACAAATTCCTTCTGTCAGGGTCC
AGTGCATTTCTGGGACTGCTGACACTTCCCCTGATCCTCTTCTCTTACTCCAGAATCATT
TCTGCCATTCTGAACATCCGCTCCTCTGAGGGCCAAGCCAAAGCCTTCTCCACCTGCTCC
TCCCACCTCACCGTGGTACTCTTGTTCTATGGGACAGCTCTATTCAGGTACATCAGCCCT
GCCTCAGGCTCGGTGTTGGAGCGAGTGGTCTCCATTCAGTACAGTGTGATCACATCTTTG
GTGAACCCCCTCATCTACAGTCTCAAGAACCAAGAGGTGAAGGCAGCTCTGCAGAGGCTG
CTGAGGCAA


Conceptual translation

MNNFTFFTEFILLGLSADCHVQTLLFVLFLGIYLLTLMGNLVMILVIRGDSHLHIPMYFF
LGHLSFLDICFSSVTMPKMLQNFLSEKKSISVWGCITQSFFFLLSGCAEASLLSAMAYDR
YAAVCYPLLYTMVMNRSLCIVMVSAAWVMGFLNSLVNNLFIHKLHFCGSNVISHFCCELP
SLFPLSCTDPTANKFLLSGSSAFLGLLTLPLILFSYSRIISAILNIRSSEGQAKAFSTCS
SHLTVVLLFYGTALFRYISPASGSVLERVVSIQYSVITSLVNPLIYSLKNQEVKAALQRL
LRQ