Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8D6 Olfactory Receptor

Gene Symbol OR8D6
Organism Dog
Family 8
Subfamily D
Pseudo No
Location chr5:10201005-10201943 (-)
Aliases cOR8D6

Sequence information


Nucleotide sequence

ATGGATACAGAAAATCATTCTTCAGTTACTGAGTTTATCCTTGAGGGGTTAACAGACCAG
CCTGGACTCCAGCTCCCTCTCTTTGTCCTGTTTCTACTTATCTATATGGTCTGCATCATG
GGAAATATGGGCTTGATCTTTTTAATCAGAATCAGTTCTCAGTTTCATATGCCCATGTAT
TATTTTCTCAGTAATCTGTCCTTCATAGATCTCTGCTACTCCACTGTCATAATTCCCAAG
CTGTTGGTGAACTTTGTTTCAGAAAAGAATCTCACCTCCTTTCCTGAGTGCATGGCTCAA
CTCTTTTTCTTCTGCTTCTTTGGTATTGATGACTCCTACATGCTGACAGCAATGGCATAT
GATCGTTATGTTGCTATCTGTAACCCCTTGCTCTATAATGTCACCATGTCCAACAGAATC
TGTTTTCTACTGGTCACCAGTGTGTATACAGTGGGCGCCATTGGAGCCTTAGTCCACACC
AGCTACATATCTAGTCGATCCTTCTGTGGAACTAATATCATCCACCATTACTTCTGTGAC
ATCCTTCCTCTTCTGAATATATCTTGTTCAAGAGACTCCACCAAGGAACTCTTGGTAATG
ATTTTGGTTGGATTCAATGTATTTGCATGTGCTTTAGCCATCTTTATCTCTTATGCCTTC
ATTCTTTCCAGCATCTTATGCATCCACTCAGCTGAAGGCAGGTCCAAAGCTTTCAGTACC
TGCAGTTCCCACCTTGCAGCTGTTGGGGTCTTCTATGGCTCCATCATCTTCATGTATTTT
AAACCATCTTCCAGCAACATAATACAGGAGAAGGTGGCTTCTGTGTTTTATACCACAGTG
ATTCCCATGCTTAACCCCCTTATCTATAGCCTTAGGAACAAGGATGTCAAGGAATCCCTT
AAAAAAGTCCTAAATAATGGGTTACTTTCTCAGTCTGCA


Conceptual translation

MDTENHSSVTEFILEGLTDQPGLQLPLFVLFLLIYMVCIMGNMGLIFLIRISSQFHMPMY
YFLSNLSFIDLCYSTVIIPKLLVNFVSEKNLTSFPECMAQLFFFCFFGIDDSYMLTAMAY
DRYVAICNPLLYNVTMSNRICFLLVTSVYTVGAIGALVHTSYISSRSFCGTNIIHHYFCD
ILPLLNISCSRDSTKELLVMILVGFNVFACALAIFISYAFILSSILCIHSAEGRSKAFST
CSSHLAAVGVFYGSIIFMYFKPSSSNIIQEKVASVFYTTVIPMLNPLIYSLRNKDVKESL
KKVLNNGLLSQSA