Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8H4 Olfactory Receptor

Gene Symbol OR8H4
Organism Dog
Family 8
Subfamily H
Pseudo No
Location chr18:39761897-39762829 (-)
Aliases cOR8H4, cOR8H4

Sequence information


Nucleotide sequence

ATGGAGAGAAAGAATAACACACCCGTGCATGACTTCATCTTTCTGGGATTGACAGATTCT
GAAGAGATCCAGTCGATCCTCTTCATGCTGTTTCTCCTAATATACCTGGTTACTGTGCTG
GGCAATGCAGGGATGATACTGATAATCCACCTGGATCTCCAGCTACACACCCCCATGTAT
TTTTTCCTTAGTCACCTGTCATTCCTTGACCTCAGTTACTCAACTGTCATCACACCTAAA
ACCTTAGAGAACTTACTGACTTCTACCAAGCATATTTCATACGGGGGCTGCCTCGTCCAG
ATGTATTTTTTTGTCTTCTTGGGGGCCACTGAATGTTTCCTTCTCTCCTCAATGGCCTAT
GATCGCTATGTTGCTATCTGTAATCCTCTGCATTACCCAGTGGTTATGTCCACAAGATTC
TGCTGTTCCCTCGTCTTTGGGTCCTATTTGATTGGCTTTGTGGACTCCTTTGTCACTGTG
CTTCGAATGAGCAGATTGCATTTCTGTGACTCCAATGTAATCCATCACTTCTTCTGTGAT
ACACCCCCAGTTTTAGCCCTGTCTTGCACTGACACACATGACATCGAAATCATGATATTT
ATTGTTGCTGGCTCCACCCTAATGGTGTCTCTTATCACAATATCTGTGTCCTATGTGTCC
ATTCTGTCTACTATCCTGAAAATTACTTCCACTTCAGGAAAGCGAAAAGCCTTCTCTACT
TGTGCCTCTCATCTCCTGGGAGTCACCATCTTTTATGGCACTATGATTTTTACTTATTTA
AAGCCAAGTAAGTCTTACTCCCTGGGAAAGGATCAAGTGGCTTCTGTTTTTTATACTATT
GTGATCCCCATGCTGAATCCACTTATTTATAGTCTTAGGAACAAAGAAGTGAAAAATGCT
CTCATTAGAGTCATGCAGAAGGGAGAAGGCAAT


Conceptual translation

MERKNNTPVHDFIFLGLTDSEEIQSILFMLFLLIYLVTVLGNAGMILIIHLDLQLHTPMY
FFLSHLSFLDLSYSTVITPKTLENLLTSTKHISYGGCLVQMYFFVFLGATECFLLSSMAY
DRYVAICNPLHYPVVMSTRFCCSLVFGSYLIGFVDSFVTVLRMSRLHFCDSNVIHHFFCD
TPPVLALSCTDTHDIEIMIFIVAGSTLMVSLITISVSYVSILSTILKITSTSGKRKAFST
CASHLLGVTIFYGTMIFTYLKPSKSYSLGKDQVASVFYTIVIPMLNPLIYSLRNKEVKNA
LIRVMQKGEGN