Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8I2P Olfactory Receptor

Gene Symbol OR8I2P
Organism Dog
Family 8
Subfamily I
Pseudo Yes
Location chr18:39776405-39777334 (-)
Aliases cOR8I3, cOR8I3

Sequence information


Nucleotide sequence

ATGGCTGGAAACAATTTCACTGAGGTGACGGTCTTCATCCTCTCTGGATTTGCAAATTAC
CCTGAACTACAAGTCAGTCTTTTCTTAATGTTTCTCTTTATTTATCTGTTCACTGTTTTG
GGGAACCTTGGGCTGATCATGTTAATCAGAATTGACTCTCAGCTTCACACACCAATGTAC
TTTTTTCTTAGCAACTTAGCATTCATTGACATATTTTATTCCTCCACTGTAACACCCAAG
GCACTGGTAAATTTCCAATCCCAACAGAAAACCATCTCTTTTGTTGCCTGCTTTGTTCAA
ATGTACTTTTTTGTGGGTTTGGTGTGCAGTGAGTGTTTTCTTCTGGGGTCAATGGCCTAG
GACCGCTACGTAGCCATCTGCAATCCTCTATTGTACTCAGTGGTTATGTCCCAGAAAGTG
TGCAACTGGCTGGGAGCCCTGCCATATGCAATAGGCTTCACAAATTCTCTGGTATCAGTC
TGTGTGATAAGTAGTTTGTCATTCTGTGATTCCAGCATCAATCATTTCTTCTGTGATACC
ACAGCTCTTTTGGCCCTATCCTGTGCAGATGCATTCAGCACAGAAATGGTGATCTTTATT
TTAGCTGGGATCACACTTCTCAGTTCCCTGCTCCTCATCACGGTCACTTACACTGCCATC
ATCTCAGCCATCCTGAGGATCCAGTCTACAGCAGGCAGACAGAAGGCCTTTTCCACCTGT
GCATCCCACCTCATGGGTGTAACTATCTTCTATGGGTCTCTGATTTTCACATATTTGCAG
CCTGATAACACATCATCCCTGACCCAGGCACAGGTGGCATCTGTCTTCTATACCATTGTC
ATTCCAATGCTGAATCCACTGATCTACAGTCTGAGGAACAAAGATGTGAAAAATGCTCTC
CTGAGAGTCATACACAGAAAACTTCTATCA


Conceptual translation

MAGNNFTEVTVFILSGFANYPELQVSLFLMFLFIYLFTVLGNLGLIMLIRIDSQLHTPMY
FFLSNLAFIDIFYSSTVTPKALVNFQSQQKTISFVACFVQMYFFVGLVCSECFLLGSMA*
DRYVAICNPLLYSVVMSQKVCNWLGALPYAIGFTNSLVSVCVISSLSFCDSSINHFFCDT
TALLALSCADAFSTEMVIFILAGITLLSSLLLITVTYTAIISAILRIQSTAGRQKAFSTC
ASHLMGVTIFYGSLIFTYLQPDNTSSLTQAQVASVFYTIVIPMLNPLIYSLRNKDVKNAL
LRVIHRKLLS