Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8J2C Olfactory Receptor

Gene Symbol OR8J2C
Organism Dog
Family 8
Subfamily J
Pseudo No
Location chr18:39702179-39703123 (-)
Aliases cOR8J4P, cOR8J4P

Sequence information


Nucleotide sequence

ATGGCCTCAGGGAACCTGACCCACCTGACTGAGTTCATTCTTAGGGGAGTCTCAGACCGC
CCAGACCTCCAGATGCCACTCTTCTTTGTTTTCCTGGTGATCTATGGGCTCACCGTGGCA
GGGAACCTGGGCATCATCACCCTCACCAGTGTTGACTCGCAGCTTCAAACACCCATGTAC
TTCTTCCTCAGGCACTTGGCTATCATCAATCTTGGCGATTCTACTGTCATTGCCCCTAAG
ATGCTGGTCAACTTCTTGGCTTCAAAGAAAACCATATCCTACTATGGATGTGCAGCCCAG
CTGGGTGGCTTCTTAGTTTTTATCGTGGGGGAGATTTTCATGCTGGCTGCAATGGCCTAC
GACCGCTACGTGGCTATTTGCAACCCCCTGCTCTACATGGTGGTGGTATCTCCGCAGATC
TGCCTTCTGCTGGTGTCCCTCATATACCTCTACAGTCTGACCACAGCACTGACCGTTTCC
TCCTGTGTGTTCTCTGTGTCATACTGCTCTTCCAACATAATCGACCATTTTTACTGTGAT
AATGTCCCTTTGTTGGCATTGTCCTGTTCTGATACCTACATTCCAGAAACAGTAGTGTTT
ACCTCTGCCGGGACCAATTTGTTTTTCTCCATGATTATTGTTCTAACCTCCTACTTCCAC
ATTGTCCTTGCCATTTTGAGGATACGTTCCTCAGAGGGCCGACGAAAAGCCTTTTCCACC
TGTGCCTCCCACATGATGGCTGTCACTGTGTTCTATGGGACCCTTCTCTTCATGTATTTG
CAACCAAGGACCAACCACTCATTAGATACTGATAAAATGGCCTCTGTCTTCTACACCCTG
GTGATACCAATGCTGAATCCCCTCATTTACAGCCTAAGGAACAAGGATGTGAAAGATGCA
TTCAAGAGATTCCTAAAGAGCCCTTGCCAGGCTTTCAAATTAGTG


Conceptual translation

MASGNLTHLTEFILRGVSDRPDLQMPLFFVFLVIYGLTVAGNLGIITLTSVDSQLQTPMY
FFLRHLAIINLGDSTVIAPKMLVNFLASKKTISYYGCAAQLGGFLVFIVGEIFMLAAMAY
DRYVAICNPLLYMVVVSPQICLLLVSLIYLYSLTTALTVSSCVFSVSYCSSNIIDHFYCD
NVPLLALSCSDTYIPETVVFTSAGTNLFFSMIIVLTSYFHIVLAILRIRSSEGRRKAFST
CASHMMAVTVFYGTLLFMYLQPRTNHSLDTDKMASVFYTLVIPMLNPLIYSLRNKDVKDA
FKRFLKSPCQAFKLV