Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8J3 Olfactory Receptor

Gene Symbol OR8J3
Organism Dog
Family 8
Subfamily J
Pseudo No
Location chr18:39543988-39544914 (-)
Aliases cOR8J7, cOR8J7

Sequence information


Nucleotide sequence

ATGGCTCCTGGAAATTTCACACAGATCACTGAGTTTGTTCTCGTGGGAGTCTCAGACCGC
CCAGACCTCCAGATGCCACTCTTCTTTGTTTTCCTGGTGATCTATGGGCTCACGGTGGCA
GGGAACCTGGGCATCATCACCCTCACCAGTGTTGACTCGCAGCTTCAAACGCCCATGTAC
TTCTTCCTCAGGCACTTGGCTATCATCAATCTTGGCGATTCTACTGTCATTTCCCCTAAG
ATGCTCTTCAATTTTTTAGTAAAAGAGAAAACCACTTTGTACTATGAATGTGCCACCCAA
CTGGGAGGATTCTTGGTTTTCATTGTAGCTGAGGTATTCACCTTAGCTGTGATGGCCTAT
GACCGCTATGTGGCCATTTGCAACCCCCTGCTCTACATGGTGGTGGTATCTCCACAGATT
TGCCTTTTCTTGGTGTCCCTCACATACCTCTACAGTTTTTCCACAGCACTTGTAGTTTCA
TCTTGTATATTTTCTCTGTCTTATTGCTCTTCCAATGTAATCAATCATTTTTTCTGTGAT
ATTGTCCCTCTGTTAACATTGTCCTGCTCAGATACTTACCTTCCAGAGACAATAGTATTT
ATATCTGCAGCTACAAATTTGGTTTTATCCTTGATTATAGTTCTAGTATCCTATTTCAAC
ATTGTTTTGTCCATTCTAAGGATGCATTCATCAGAAGGAAGGAAAAAAGCCTTTTCCACA
TGTGCTTCACATATGATGGCAGTCACAGTTTTCTACGGAACACTACTATTCATGTATTTG
CAGCCTCAAACTAACTACTCATTGGATACTGATAAAATTGCTTCTGTATTTTATACCCTG
GTGATCCCCATGTTGAATCCCATGATCTACAGCCTGCGGAATAAGGATGTGAAGGCTGCC
TTACAGAGATTTCTGAAAAACTCATGC


Conceptual translation

MAPGNFTQITEFVLVGVSDRPDLQMPLFFVFLVIYGLTVAGNLGIITLTSVDSQLQTPMY
FFLRHLAIINLGDSTVISPKMLFNFLVKEKTTLYYECATQLGGFLVFIVAEVFTLAVMAY
DRYVAICNPLLYMVVVSPQICLFLVSLTYLYSFSTALVVSSCIFSLSYCSSNVINHFFCD
IVPLLTLSCSDTYLPETIVFISAATNLVLSLIIVLVSYFNIVLSILRMHSSEGRKKAFST
CASHMMAVTVFYGTLLFMYLQPQTNYSLDTDKIASVFYTLVIPMLNPMIYSLRNKDVKAA
LQRFLKNSC