Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8K1 Olfactory Receptor

Gene Symbol OR8K1
Organism Dog
Family 8
Subfamily K
Pseudo No
Location chr18:39,559,300-39,560,200 (-)
Aliases cOR8K1

Sequence information


Nucleotide sequence

ATGAACCATATGGATAAACAGAATTATACTGCAGTGAGTGAGGTGACTGAATTTATTCTC
ATGGGAATCACCAAAAACCCTCGACTTCAAGCACCCCTCTTTGGAATCTTCTTCATCATA
TACTTGGTCACGGTGACAGGCAATCTGGGCATAATTATCTTGACCCATTTGGACTCCAGG
CTACAGACTCCGATGTACTTTTTCCTTAGACATTTGTCAATTACTGATCTTGGTTACTCT
ACTGTCATTGGCCCAAAAATGATGGTAAATTTTGTGGTGCACAAAAATACAATCTCCTAC
CATTGGTGTGCCACCCAGCTGGCAGTCTTTGAGATTTTCATCATCACTGAACTGTTTATT
CTTTCAGCAATGGCCTATGATCGCTATGTAGCCATCTGCAAACCTCTTTTGTATGCGGTC
ATCATGGCAGAGAAGGTACGTTGGGCGCTGGTCCTTGTTCCCTATCTCTACAGCATATTT
GTGTCTCTTTTTCTTACAATTAAGTTATTTAAACTGTCCTTCTGTGGATCTAACATTATC
AGTTATTTTTACTGTGACTGCCTTCCTCTCATATCCCTGCTCTGTTCTGACACACATGAG
TTAGAATTGATCATTTTAATTTTTTCAGGCTGTAATTTGCTCTCTTCTCTCTTGATTGTT
CTTGTATCCTATATATTTATTCTTGTGGCCATTATCAGAATGAACTCAACTGAAGGGAGA
TACAAAGCCTTCTCCACCTGTAGCTCCCATCTGACAGTGGTGACTGTGTTCTATGGGACA
TTACTCTTTATTTACCTGCAACCCAAATCCAGCCATACATTTGATATTGATAAAATGGCT
TCTGTGTTTTATACTCTGGTGATCCCTATGCTGAATCCATTGATCTACAGCTTAAGGAAC
AAAGAAGTAAAAGGTGCTCTGAAGAGAACTTTAACCAATGGGTGCAAAATCCCCACT


Conceptual translation

MNHMDKQNYTAVSEVTEFILMGITKNPRLQAPLFGIFFIIYLVTVTGNLGIIILTHLDSR
LQTPMYFFLRHLSITDLGYSTVIGPKMMVNFVVHKNTISYHWCATQLAVFEIFIITELFI
LSAMAYDRYVAICKPLLYAVIMAEKVRWALVLVPYLYSIFVSLFLTIKLFKLSFCGSNII
SYFYCDCLPLISLLCSDTHELELIILIFSGCNLLSSLLIVLVSYIFILVAIIRMNSTEGR
YKAFSTCSSHLTVVTVFYGTLLFIYLQPKSSHTFDIDKMASVFYTLVIPMLNPLIYSLRN
KEVKGALKRTLTNGCKIPT