Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8K5 Olfactory Receptor

Gene Symbol OR8K5
Organism Dog
Family 8
Subfamily K
Pseudo No
Location chr18:39,566,100-39,567,100 (-)
Aliases cOR8K7, cOR8K6P

Sequence information


Nucleotide sequence

ATGGGTAAACAGAACCTAACGTCAGTGACTGAGTTCATTCTGATGGGAGTCACACGGCAG
CCTGAGCTTCAAGTTCCTCTTTTTGGGGTCTTCCTCATCATCTACATGATCACAGTGGTG
GGAAATTTGGGCATGATCACCTTGATCCAGGTGGACTCCCGCCTCCACACACCTATGTAT
TTTTTTATCAAACACCTGGCTTTCATTGACCTTGGTAATTCTACTGTCATCTGTCCCAAG
ATGCTGGTAAATTTTGTTGTGGACCAAAATATCATTTCTTATTATGCATGTGCCACACAG
TTGGCTTTCTTCCTTATGTTCATTATCAGTGAATTTTTCATCTTGTCAGCTATGGCCTAT
GACCGCTATTTGGCCATCTGTAACCCTTTGCTCTACAACGTTATTATGTCCCAGAGACTT
TGCTACATGCTGGTGGGCATTCCATACCTCTACAGTACCTTTCAGGCTCTACTGTTCACT
ATTAAGATTTTCACACTGACCTTCTGTGGATCTAATGTTATCAATCATTTCTATTGTGAT
GATGTTCCCTTGTTACTTATACTCTGCTCAAATGCACAAGAAATAGGATTGTTGATCATA
CTATTTTCAGCATTGAATTTGATCTCTTCTTTCCTGGTAGTCCTAGTGTCCTACATACTA
ATTCTGACATGCATATTTCAAATCCATTCTACAGAGAGCAGGAAAAAAGCTTTCTCCACA
TGTGGTTCTGATCTGACAGTGGTAGTTGTATTCTATGGGTCTCTGCTATTTATGTACATG
CAGCCCAAATCTGCCCATTCTTTTGAAACTGACAAAATGGCCTCCGTATTTTACACTTTA
GTGATCCCCATGCTTAACCCCTTAATCTACAGcctaaggaacaaagaggtaaaaaatgct
ttccgcaggttcttttttttttttttttttCCGCAGGTTCTT


Conceptual translation

MGKQNLTSVTEFILMGVTRQPELQVPLFGVFLIIYMITVVGNLGMITLIQVDSRLHTPMY
FFIKHLAFIDLGNSTVICPKMLVNFVVDQNIISYYACATQLAFFLMFIISEFFILSAMAY
DRYLAICNPLLYNVIMSQRLCYMLVGIPYLYSTFQALLFTIKIFTLTFCGSNVINHFYCD
DVPLLLILCSNAQEIGLLIILFSALNLISSFLVVLVSYILILTCIFQIHSTESRKKAFST
CGSDLTVVVVFYGSLLFMYMQPKSAHSFETDKMASVFYTLVIPMLNPLIYSLRNKEVKNA
FRRFFFFFFFPQVL