Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8S1 Olfactory Receptor

Gene Symbol OR8S1
Organism Dog
Family 8
Subfamily S
Pseudo No
Location chr27:6107222-6108157 (-)
Aliases cOR8S17

Sequence information


Nucleotide sequence

ATGGACTTGGGGAACCACAGCACCATCACGGAGTTTATCCTCCTTGGGCTCTCTGCTGAC
CCTCACATCCAGGTTGCACTCTTTGTTCTCTTCCTGGGGATTTACCTCCTGACTGTGATG
GGGAACCTGATTATGCTGCTGGTGATCAGGACTGATTCCCACCTCCATACACCCATGTAC
TTCTTCCTGAGTCACCTCTCTTTTGTTGATATCTGCTTCTCTTCGGTCACTGTGCCCAAG
ATGCTGGAGAACCTTCTTTCTCAAAAGAAAACCATCTCAGTAGAGTGCTGCCTCACTCAA
GTCTTCTTCGTGTTTGTTGCTGCAGGAACTGAAGCCTGTCTGCTCTCAGTGATGGCCTAT
GACCGCTATGCTGCCATCTGCCACCCACTGCTCTATGGACAGATCATGAATAAACAGCTG
TATATGCAGCTTGTATGGGGATCATGGGGACTGAGCTTTCTGGATGCACTCATCAACATC
TTTCTAGCTATGAAGATGGTCTTCTGCAAAGCCCAAATCATCCCCCACTACAGCTGTGAA
ATGCCCTCTCTCCTCTCATTGTCCTGTTCTGATACCTCCAAAAACCTCATTGCCTTGCTC
TGCTCCACTCTTCTGCATGGGCTGGGAACCTTCCTTTTGGTCTTCTTATCCTATGCCCGT
ATTATTGCCACTATCCTGAGCATCAGCTCCACCTCAGGCAGAAGCAAGGCCTTCTCCACC
TGCTCCTCACACCTCACTGCAGTGACTCTTTATTATGGCTCAGGTTTGCTCCGCCATCTC
ATGCCAAATTCAGGATCCCCCCTCGAGTTGATCTTTTCTGTACAGTATACTGTAGTCACT
CCTGTGCTGAATCCTCTCATCTACAGCCTGAAGAACAAGGAGGTGAAGGCAGCTCTGACA
CGAACTATGGAAAAGTATTTGCAACATATCAGGTGC


Conceptual translation

MDLGNHSTITEFILLGLSADPHIQVALFVLFLGIYLLTVMGNLIMLLVIRTDSHLHTPMY
FFLSHLSFVDICFSSVTVPKMLENLLSQKKTISVECCLTQVFFVFVAAGTEACLLSVMAY
DRYAAICHPLLYGQIMNKQLYMQLVWGSWGLSFLDALINIFLAMKMVFCKAQIIPHYSCE
MPSLLSLSCSDTSKNLIALLCSTLLHGLGTFLLVFLSYARIIATILSISSTSGRSKAFST
CSSHLTAVTLYYGSGLLRHLMPNSGSPLELIFSVQYTVVTPVLNPLIYSLKNKEVKAALT
RTMEKYLQHIRC