Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8S15 Olfactory Receptor

Gene Symbol OR8S15
Organism Dog
Family 8
Subfamily S
Pseudo No
Location chr27:6020081-6021025 (-)
Aliases cOR8S15

Sequence information


Nucleotide sequence

ATGGCCTCAGCGAATCACAGCAGAATCACGGAGTTCATCCTTCTTGGGCTGTCTGCTGAC
CCCTATGTCCAGGCTCTACTCTTTGTTCTGTTCCTGATGATTTACCTTCTGACTCTACTG
GGGAATCTTCTGATAATACTTGTGATCCATACAGATGCTAACCTCCACATGCCCATGTAC
TTCTTTCTGGGCCATCTCTCCTTCCAAGACCTCTTCTACTCTACAGTCACTGTGCCCAAG
CTGCTGGAGAACCTCCTGTCTCAGAGGAAAACCATCTCAGTGGAGGGCTGCCTGGCTCAG
GTGTTCTTTGTGTTTGCCACTACAGGGATTGAAGCCTGCCTGCTTTCGGTGATGGCCTAT
GACCGCTATGCTGCCATCTGCCACCCTCTGCTTTATGGCCAGGTGATGAGTAAACAGCTA
TGTGAGAGGTTGGTGTGGGGCTCTTGGGTCGTGGCCTTTCTGGATGCACTCATGAACATC
CTCCTGGCTTTGAATATGGACTTCTGTGAGGCTCAAACCATCCACCACTACTCCTGTGAG
CTGCCTTCCCTCTTCCCTCTCTCCTGCTCTGATGTCTCCACCAACTCTGCAATGCTACTC
TGCTCTGCCCTCCTGCATGCCATTGGGACATGCCTCCTGATCTTCTTCTCTTATGTGCGC
ATTGTCTCTACCATCCTGAGCATCAGCTCCACCACAGGCAGAAGCAAGGCCTTCTCCACC
TGCTCCTCCCACCTCACTGCAGTGATCCTGTTCTATGGCTCAGCCCTTCTTCGCTATCTC
ATGCCAACCTCAGGGTCACCTCTAGAGTTGATCCTCTCCATACAATACAGTGTAATCACT
CCCTTGGTGAATCCACTCATCTACAGCTGGAAGAACAAGGAGGTGAAAGCAGCTCTGAGA
AGAATGATGATAAAATACTTACGATGTCTCAGCACAGAAGAGATA


Conceptual translation

MASANHSRITEFILLGLSADPYVQALLFVLFLMIYLLTLLGNLLIILVIHTDANLHMPMY
FFLGHLSFQDLFYSTVTVPKLLENLLSQRKTISVEGCLAQVFFVFATTGIEACLLSVMAY
DRYAAICHPLLYGQVMSKQLCERLVWGSWVVAFLDALMNILLALNMDFCEAQTIHHYSCE
LPSLFPLSCSDVSTNSAMLLCSALLHAIGTCLLIFFSYVRIVSTILSISSTTGRSKAFST
CSSHLTAVILFYGSALLRYLMPTSGSPLELILSIQYSVITPLVNPLIYSWKNKEVKAALR
RMMIKYLRCLSTEEI