Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8S8 Olfactory Receptor

Gene Symbol OR8S8
Organism Dog
Family 8
Subfamily S
Pseudo No
Location chr27:5928242-5929168 (-)
Aliases cOR8S8

Sequence information


Nucleotide sequence

ATGGCCTGGAGGAACCACAGCACCATCACGGAGTTCATTCTCCTTGGGCTGTCCGACGAC
CCCTACATCGAAGCTCTGCTCTTTGTGTTCTTCCTGGGGATCTACCTCCTGACTATGATG
GGGAACCTGATGATGCTGCTGGTGATCAGGGCTGATTCCCGCCTCCACACTCCCATGTAC
TTCTTCCTGAGTAACCTGTCCTTCCTAGACCTCTGCTTCTCTTCTGTCACTGTGCCCAAG
CTCCTGAAGGACCTTCTGTCTGAGAAGAGAACCATCTCAGTGGAGGGCTGCCTCACCCAG
GTGTTCTTTGTGTTTATCACTGCAGGGACCGAAGCCTTTCTGCTCTCAGTGATGGCCTAT
GACCGCTATGCTGCCATCTGCCACCCACTGCTCTATGGCCAGGTGATGAGCACCCAGTTC
TGTGTGAAGCTCGTGTTGATCTCATGGGGTCTGGCCTGCCTGAATTCGGTTGTGATTGTG
TTCTTGGCTATTAACCTGGACTTCTGTGAGGCCCAAACTATACATCATTACATCTGTGAG
CTGCCCTCCCTCTTCCCTCTCTCTTGCTCAGATATTTCTATCAATGTTGACATCTTGATC
TGCTCCATCTTACTGCATGGGCTTGGGACCTTCCTCCCAATCTTCTTCTCCTATGCCCGT
ATTGTCTCCACCATCCTGAGCATCAGCTCTACCTCAGGCAGAAGCAAGACCTTCTCCACC
TGCTCTTCCCACCTCATTGCAGTGACTCTGTTCTTTGGCTCAGGTTTGATTCGCTACCTT
ATGCCCACCTCCGGTTCCTCCCTGGATTTGCTCTCCTCCTTGCAGTACAGTGCAGTCACA
CCCTTGCTGAATCCCCTCATCTACAGCCTAAAGAATAAAGAAGTGAAGGCAGCTGTGAGA
AGGACACTAGGAAAATACCTACACTCT


Conceptual translation

MAWRNHSTITEFILLGLSDDPYIEALLFVFFLGIYLLTMMGNLMMLLVIRADSRLHTPMY
FFLSNLSFLDLCFSSVTVPKLLKDLLSEKRTISVEGCLTQVFFVFITAGTEAFLLSVMAY
DRYAAICHPLLYGQVMSTQFCVKLVLISWGLACLNSVVIVFLAINLDFCEAQTIHHYICE
LPSLFPLSCSDISINVDILICSILLHGLGTFLPIFFSYARIVSTILSISSTSGRSKTFST
CSSHLIAVTLFFGSGLIRYLMPTSGSSLDLLSSLQYSAVTPLLNPLIYSLKNKEVKAAVR
RTLGKYLHS