Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8S9 Olfactory Receptor

Gene Symbol OR8S9
Organism Dog
Family 8
Subfamily S
Pseudo No
Location chr27:6032245-6033198 (-)
Aliases cOR8S9

Sequence information


Nucleotide sequence

ATGGTCTTAGGAAACCACAGCACCATCACAGAATTCATCTTCCTTGGACTGTCTGCTGAC
CCCCACATCCAGATTCTGCTCTTTGTGCTTTTCCTAGCAATTTACCTCCTGACTATCATG
GGGAACCTGATGATAATGATAGTGACTATGACTGATACCCATCTCCACACCCCCATGTAC
TTCTTCTTGAGCCACCTCTCCTTCCTGGATCTTTGTTTAACTTCAGTAATTGTGCCCAAG
ATGCTGGAGAATCTCGTATCTCACAAGAAATCAGTATCAGTAGAAGGCTGCCTCACTCAG
GCATTTTTCGTGTTTTCCATCGCTGGAACTGAAGTTTTTGTGCTCTCTGCCATGGCCTAT
GACCGCTATACTGCCATCTGCTACCCCCTGCTCTATGGCCAGCTGATGAGTAAACAGTTG
TGTGGGGGTCTGGTATGGGTCTCATGGGCACTGGGCTTTCTGGATGCTCTCATTAACACC
CTCATGGCTTGGAATTTGGACTTCTGTGAGGTTCAGGTCATCCCTCACTTCAGCTGTGAA
CTGCCATCTCTATTCCCTCTATCTTGCTCTGACATCTCCACCAACTTTACAGTCCTGGTG
TGCTCTGCCATCATTCATGCCTCTGGAACCTTGCTTCTGGTCTTCTTCTCATATACTCGC
ATTGTCTCCACCATCCTGAGCATCAGCTCCACCTCAGGCAGAAGTAAAGCCTTCTCCACC
TGCTCCTCCCACCTCACTGCAGTGAGCTTTTTCTATGGATCTGCTTTTCTTCGCTATTTC
ATGCCAATCTCAGGCTCACCTCTGGAGCTGATTTTCTCCATACAGTACAGTGTGGTCACT
CCTCTAATAAATCCCCTTATTTACAGCTTGAAGAACAAGGAAGTAAAATCAGCTCTGAAA
AGAATGCTGCAAAAAGGTTTAAAACAGCTCAGAGAGCAGAGAACAGGCAGTGGA


Conceptual translation

MVLGNHSTITEFIFLGLSADPHIQILLFVLFLAIYLLTIMGNLMIMIVTMTDTHLHTPMY
FFLSHLSFLDLCLTSVIVPKMLENLVSHKKSVSVEGCLTQAFFVFSIAGTEVFVLSAMAY
DRYTAICYPLLYGQLMSKQLCGGLVWVSWALGFLDALINTLMAWNLDFCEVQVIPHFSCE
LPSLFPLSCSDISTNFTVLVCSAIIHASGTLLLVFFSYTRIVSTILSISSTSGRSKAFST
CSSHLTAVSFFYGSAFLRYFMPISGSPLELIFSIQYSVVTPLINPLIYSLKNKEVKSALK
RMLQKGLKQLREQRTGSG