Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8U10 Olfactory Receptor

Gene Symbol OR8U10
Organism Dog
Family 8
Subfamily U
Pseudo No
Location chr18:39,476,800-39,477,800 (-)
Aliases cOR8U10

Sequence information


Nucleotide sequence

ATGGCTGAAAGGAATAGCACCAAGGTGACAGAATTCATTCTTTTGGGTTTTTCCGTCCAC
AGAGAGATTGAAATCATTCTCTTTCTGCTCATTTCAGTGGTCTACACTCTAACATTGGTA
GGGAACCTAGGGATGATTTCTTTAATCCGATTGGATTCTCGACTTCACACACCCATGTAC
TTTTTTCTCAGTAATCTGGCCTTTATAGACCTCTGTTACTCCTCATCGATAGCCCCCAAG
TTCCTGGAGACCCTCCTGACCAAGCACAGGTCTATATCTTTCTATGCATGTGCAACACAG
CTGGGCTTTTTCTTGAACTTCCTGATTTCTGAGATGTTCCTTCTTGCAGTAATGGCTTAT
GACCGTTATGTGGCCATCTGCAATCCTCTTCTCTACATGATGATCATGTCTCGAAAGGTG
TGTATGCAGCTGGTGATAGGCCCCTACTTATACAGCTTTTCTGTTGCTTTGCTCCACACA
GTTGTTACTTTCCAACTGATGTATTGTGGCCCCAATATCATCAATCACTTCTATTGTGAC
GATGTTCCTTTGATGGCACTTGCCTGCTCGGACACCAGCCTCAAAGAAATCTTGATTTTC
ATCTTTGCTGGATTCAACATGATCAGCTCTTTGACCACTGTTCTTATTTCTTACTTATAC
ATTGTGGCCGCCATCTTGAAAATCCAGTCTACAGAAGGGAGGTGCAAAGCTTTCTCGACT
TGTGCTTCTCATTTGACTGCTGTGACTATATTCTATGGGACATTGATCTTCATGTATCTG
CAGCCAAAATCAAACCACTCCCTTGACACAGACAAAATGGCCTCTGTATTTTACACAATA
GTAATTCCTATGCTAAACCCCATTATCTATAGCTTGAGGAACCAAGAGGTAAAAAATGCC
TTAAGAAAAGCAACTGACAAGTGTTATGTCCTGTTTCTAACAAACCTAAAAAAA


Conceptual translation

MAERNSTKVTEFILLGFSVHREIEIILFLLISVVYTLTLVGNLGMISLIRLDSRLHTPMY
FFLSNLAFIDLCYSSSIAPKFLETLLTKHRSISFYACATQLGFFLNFLISEMFLLAVMAY
DRYVAICNPLLYMMIMSRKVCMQLVIGPYLYSFSVALLHTVVTFQLMYCGPNIINHFYCD
DVPLMALACSDTSLKEILIFIFAGFNMISSLTTVLISYLYIVAAILKIQSTEGRCKAFST
CASHLTAVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTIVIPMLNPIIYSLRNQEVKNA
LRKATDKCYVLFLTNLKK