Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR8V2 Olfactory Receptor

Gene Symbol OR8V2
Organism Dog
Family 8
Subfamily V
Pseudo No
Location chr18:39,690,200-39,691,200 (-)
Aliases cOR8V2

Sequence information


Nucleotide sequence

ATGACTCTTGTGATGGTTGTTCCCACAGCAATTTCGCTTAATGGCCTGGATGAACAAAAT
CTAACAGTGCTAACAGAATTCATCCTAATGGGAATCACCGACCATCCTGAGCTGCAGGCT
CTCTTCTTTGGGCTTTTCCTCATCATCTACACAGTTTCAGTGGTGGGCAACCTGGGCATG
ATCATCCTCACCAAGGTGGACTCCAGGCTCCAAACACCCATGTACTTCTTCCTCAGACAC
CTGGCTTTCATTGATCTTGGCTACTCATCAGCTGTGGCACCCAAAATGTTAGTAAATTTT
GTAGCTGATCAAAATACAATCCCCTATAACTGGTGCGCTACCCAGCTGGCTTTCTTCATC
TTGTTCATCATCAGTGAGCTGTTCAATCTATCTGCAATGGCCTATGACCGTTATGTGGCC
ATCTGTAACCCTCTGCTCTACACCATTGTTATGTCACAAAGAGTGTGCTGGGGGCTGATA
ACAATCCCTTATGTCTACAGTGCCTGTCTCTCTCTGATAATCACCATCAAGATTTTTATG
GCATCCTTCTGTGGACATAATGTCATTAGACATTTTTACTGTGATAGTCTTCCCTTGTTA
ACTTTGCTGTGTTCAAGCACACGTGACATTGAGTTGATAATACTGATCTTTTCAGCATTT
AATTTGATTTCCTCCCTTCTCATAGTGCTTGTGTCCTACATCCTCATCCTTATGGCCATC
CTTAGGATGAACTCTGCAGAGGGCAGGCACAAGGCCTTCTCCACCTGTGGATCCCACCTG
ACGGTGGTTGTTGTATTGTATGTCACTCTCTTCTTCATGTACGTGCAGCCCAAATCCAGT
CATTCCTTTGATACTGATAAAATCGCCTCTATATTTTACACTTTGATAATCCCTATGCTG
AATCCCATGATCTACAGTCTAAGGAACAAAGAGGTAAAAGGTGCCCTGCATAGAATATGG
AAAAACCTGCATAAACCACCTGTG


Conceptual translation

MTLVMVVPTAISLNGLDEQNLTVLTEFILMGITDHPELQALFFGLFLIIYTVSVVGNLGM
IILTKVDSRLQTPMYFFLRHLAFIDLGYSSAVAPKMLVNFVADQNTIPYNWCATQLAFFI
LFIISELFNLSAMAYDRYVAICNPLLYTIVMSQRVCWGLITIPYVYSACLSLIITIKIFM
ASFCGHNVIRHFYCDSLPLLTLLCSSTRDIELIILIFSAFNLISSLLIVLVSYILILMAI
LRMNSAEGRHKAFSTCGSHLTVVVVLYVTLFFMYVQPKSSHSFDTDKIASIFYTLIIPML
NPMIYSLRNKEVKGALHRIWKNLHKPPV