Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR9G1B Olfactory Receptor

Gene Symbol OR9G1B
Organism Dog
Family 9
Subfamily G
Pseudo No
Location chr18:39,257,400-39,258,300 (-)
Aliases cOR9G8

Sequence information


Nucleotide sequence

ATGGAGAGAGGCAATCATACAGTGACTGAGTTCATCCTGGTGGGCTTCACGACAGACCCA
GTGATGCAGCTGGTCCTGTTTGTGGTATTCCTTGGCGTGTACTCTCTGACTGTGGTAGCA
AATGCCACCCTCATAGTTTTGATCTGTAATGACTCCCGGCTGCACACACCCATGTATTTT
TTCATTGGGAATCTATCTTTTCTGGATCTCTGGTATTCCTCTGTCTACACTCCGAAAATC
CTCATGACCTGCATCTCTGAAGACAAAAGCATCTCCTTTGCTGGCTGTGTATGTCAGTTC
TTCTTCTCTGCAGGGCTGGCATATACTGAGTGTTACCTGTTGGCTGCCATGGCTTATGAC
CGCTATATGGCCATCTCAAAGCCACTGCGCTATGCTCAGGCCATGTCTATAAAGCTGTGT
GCATTTTTGGTAGCATCCTCATATCTTGGTGCTTTTATTAACTCTTCTATCATCACCAAA
AGAACTTTTGCCTTAGACTTCTGTAGTGGCAATGTTATTGATGACTTTTTTTGTGATTTG
CTGCCCCTGGTGAAGTTGGCTTGTGGCAGAAAAGATGGCTACCAGGCTATACTGTACTTC
CTTCTGGCCTCCAATGTCATCACCCCTACAGTGCTCATCCTAGCCTCCTACCTGTTCATC
ATTGGCGCCATCTTGAGGATCCGCTCCACCCAGGGCCGCCTCAAAGCCTTCTCTACATGT
TCCTCACACCTGGTCTCTGTCACCTTGTACTATGGCTCCATTCTCTACATCTACTCTCGT
CCCCGATCTAGCTATTCTTTGGACACAGACAAAATAGTTTCCACATTTTATACTGTGGTG
TTCCCCATGCTGAATCCTATGATCTATAGCCTGAGGAATAAGGATGTGAAAGAGGCTCTG
AATAAACTCATTAAA


Conceptual translation

MERGNHTVTEFILVGFTTDPVMQLVLFVVFLGVYSLTVVANATLIVLICNDSRLHTPMYF
FIGNLSFLDLWYSSVYTPKILMTCISEDKSISFAGCVCQFFFSAGLAYTECYLLAAMAYD
RYMAISKPLRYAQAMSIKLCAFLVASSYLGAFINSSIITKRTFALDFCSGNVIDDFFCDL
LPLVKLACGRKDGYQAILYFLLASNVITPTVLILASYLFIIGAILRIRSTQGRLKAFSTC
SSHLVSVTLYYGSILYIYSRPRSSYSLDTDKIVSTFYTVVFPMLNPMIYSLRNKDVKEAL
NKLIK