Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR9G4 Olfactory Receptor

Gene Symbol OR9G4
Organism Dog
Family 9
Subfamily G
Pseudo No
Location chr18:39241055-39241990 (+)
Aliases cOR9G4, cOR9G4

Sequence information


Nucleotide sequence

ATGGAAGTAGGAAACCGTACCATTCTGACTGAATTCATCTTGGTGGGCTTCTCAGCAGAC
CCACGGTGGCAGCTGATTCTATTTGGAATATTTCTGATGCTCTATTTGATGACTTTGTCA
GGGAACATGACCCTGGTTATCCTAATCCGAATTGATTCCCGCCTGCACACCCCTATGTAC
TTCTTCATTGGCAATTTGTCCTTTTTGGATTTTTGGTACACTTCTGTGTATACTCCCAAA
ATCTTGGCTAATTGTGTCTCAGAAGATAAACGTATTTCCTTGGCTGGATGTGGAGCCCAG
TTGTTCTTTTCCTGTGTTGTAGCCTACACAGAATGCTATCTCCTAGCCGCCATGGCATAT
GACCGGTATGCAGCAATCTGTAACCCATTGCTTTATTCAAGTATGATGTCCAATTCTCTC
TGTACTGGGCTTGTTGCTGGCTCCTACTTAGGAGGACTTTTGAATGCCATAGCCCATACT
GCTAACACTTTCCGCTTGAGTTTCTGTGGTAAAAATATCATTGACCACTTCTTCTGTGAT
GCACCACCATTGGTAAAAATGTCTTGTACAGATACCCATGTCTATGAAAAAGTCCTCCTG
GGTGTGGTGGGCTTCACAGTCCTCTCCAGCATTCTTGCCATCCTGGTTTCCTATTGCAAC
ATCCTTCTGGCTATCCTGAGGATCCGCTCGGCTTCAGGAAGGCGCAAAGCCTTCTCCACC
TGTGCTTCACACCTCATTTCGGTCATGCTCTTCTATGGATCCTTGCTCTTCATGTATTCA
AGGCCAAGTTCCACCTACTCCCTGGAGAGAGACAAAGTGGCTGCTCTGTTCTACACTGTG
GTCAACCCATTGCTCAACCCTCTCATCTATAGCCTGAGAAACAAAGACGTCAAAGAGGCC
TTCTGGAAAGCAACACAAACCATAAGGCTGCAGAGA


Conceptual translation

MEVGNRTILTEFILVGFSADPRWQLILFGIFLMLYLMTLSGNMTLVILIRIDSRLHTPMY
FFIGNLSFLDFWYTSVYTPKILANCVSEDKRISLAGCGAQLFFSCVVAYTECYLLAAMAY
DRYAAICNPLLYSSMMSNSLCTGLVAGSYLGGLLNAIAHTANTFRLSFCGKNIIDHFFCD
APPLVKMSCTDTHVYEKVLLGVVGFTVLSSILAILVSYCNILLAILRIRSASGRRKAFST
CASHLISVMLFYGSLLFMYSRPSSTYSLERDKVAALFYTVVNPLLNPLIYSLRNKDVKEA
FWKATQTIRLQR