Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR9I2 Olfactory Receptor

Gene Symbol OR9I2
Organism Dog
Family 9
Subfamily I
Pseudo No
Location chr18:38218146-38219126 (-)
Aliases cOR9I2, cOR9I2

Sequence information


Nucleotide sequence

ATGAGATTTTATTTTTTGATTTCAGTGGATGACCTAGGATTCATGGAGAAGAATGGCACC
ATGGTGACGGAATTCATTCTGCTGGGGTTCCAGCTGCCGGCAGAGCTGCAGATGGGTCTC
TTCCTTGTGTTTCTGGTCCTTTATTTCATTACCTTGGTGGGCAACCTGGGCATGATCGTG
TTGATTCAGAGAGACCCTCGTCTCCAAACCCCCATGTACTTCTTCCTCTGCCATCTTTCC
TTCTTGGATATTTGCTATTCCTCTGTCATTGTCCCTCAGTTTCTTGAAACCTTGGGTACC
GATAAGATGGCCATCACCTATGAGTGCTGTGCCACTCAGTTCTTCTTCTTTACCCTCTGT
GCTAGCACTGAATGTTTCCTTTTGGCTGTGATGGCCTATGACCGCTATGTGGCGGTGTGT
AACCCCCTCCTCTATGCCACTGCCATGACACCACAGACTTGCCTGGGGCTGGTGACTGGG
GCATATGCTGGTGCCATGGTCAATGCTGTGATCCGCACTGGGTGTACCTTCTCTATCTCT
TTCTGTAAGTCCAACCACGTGGACTTCTTCTTTTGTGACCTCCCACCCCTGCTGAAGCTT
GCCTGTAGTGACACCAAGTTACGGGAACGGGTCATTTACCTCTTAGCTTTCTTGGTCATT
ACAACCAGTATTTCAGTGATTCTTATATCCTACTTTTTCATCATTCAGGCTATTCTGAAG
ATTCGTACAGCAGGTGGCAAAGCCAAGACTTTCTCCACCTGTGCTTCTCACATGACCGCA
GTAGCTCTTTTCTTTGGGACACTCATATTCATATACCTGAAAGGTAACATGGGAAAGTCC
CTTGGGGAGGACAAGATTGTGTCAGTATTTTACACTGTGGTCATCCCTATGTTGAACCCA
ATGATCTATAGCTTGAGAAACAAGGAAGTGAAGGAGGCTCTGAAGAAAGCTTTCAATGGG
ATGAAGGTTTCCCAAGCAGAC


Conceptual translation

MRFYFLISVDDLGFMEKNGTMVTEFILLGFQLPAELQMGLFLVFLVLYFITLVGNLGMIV
LIQRDPRLQTPMYFFLCHLSFLDICYSSVIVPQFLETLGTDKMAITYECCATQFFFFTLC
ASTECFLLAVMAYDRYVAVCNPLLYATAMTPQTCLGLVTGAYAGAMVNAVIRTGCTFSIS
FCKSNHVDFFFCDLPPLLKLACSDTKLRERVIYLLAFLVITTSISVILISYFFIIQAILK
IRTAGGKAKTFSTCASHMTAVALFFGTLIFIYLKGNMGKSLGEDKIVSVFYTVVIPMLNP
MIYSLRNKEVKEALKKAFNGMKVSQAD