Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR9I4P Olfactory Receptor

Gene Symbol OR9I4P
Organism Dog
Family 9
Subfamily I
Pseudo Yes
Location chr18:38253465-38254357 (+)

Sequence information


Nucleotide sequence

ATGGAGTTCATCCTTGTGGGCTTCACAGATCACCCTGAACTGATGATTCCCCTCTTCCTG
ATGTTTCTCATTTTCTATATCATCACCCTTCTGGGGAATGTGGGAATTATCATTCTGATC
CAAGTGGATGTCCAACTCCACACCCCCCCATGTACTTCTTCCTGAGCCATCTCGCCCTGC
TGGATGCCTGCTATGCCTCAGTGATCACCCCTCAGATCCTGGACAGACACACTGGCCACA
GGCAAGATAGTCATCTCCTTTGGTCAATGTGCTATGCGGTCTTTTCTTCACCATCTTTGC
AGGCACAGAGTGTTTCCTGCTGGCAGTGATGGTCTATGACCACTTTGTTGCCATCAGCAA
CTCATTGCATATAACCTGGCCATGACTCCAGGCACCTGCAGGGGATCCTTGGCTGCAGCC
TATGTCTATGGGGTATCAGGGGACATCCTGCATACCACATGCACCTTCACCCTCTCCTTC
TGTGACCACAATCAGTTCAACTTCTTCTGTGACTTCCCATCCCTGCTGAAGCTTGCCTGG
AACAGCATGACATAAAATGTGATTGTCATCCTCTTTTTGCCAAGTTCATGTTCCTTGCCA
ATGTCATGATCATCATGGCGTCCTATATGCTCATAATCAGAGCCATCCTGAGGGTGAGGT
CTGCTGGTGGGAGAGCCAAGATCATCTCCACATATGCCTCCCACCTCACCACTGTTGTCC
TCTTCTTCGGGACACTTGCCTTCATGTACCAGAGAAGTAACTCAGACCAATTCCCAGAGG
AGAAGATTGTGTCTGTCTTTTACCCCATGGTCATCCCCCTGTTGAACCCCTTGATCTACA
GCCTGAGGAACAAAGATGTAAAAGCTACATTCAGGAAAGTCATTGATAAAATC


Conceptual translation

MEFILVGFTDHPELMIPLFLMFLIFYIITLLGNVGIIILIQVDVQLHT/PMYFFLSHLA
LLDACYASVITP\SWTDTLATGKIVISFGQCAMR\FFTIFAGTECFLLAVMVYDHFVA
ISNSL/YNLAMTPGTCRGSLAAAYVYGVSGDILHTTCTFTLSFCDHNQFNFFCDFPSLL
KLAWNSMT*NVIVIL/FAKFMFLANVMIIMASYMLIIRAILRVRSAGGRAKIISTYASH
LTTVVLFFGTLAFMYQRSNSDQFPEEKIVSVFYPMVIPLLNPLIYSLRNKDVKATFRKVI
DKI