Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR9M1 Olfactory Receptor

Gene Symbol OR9M1
Organism Dog
Family 9
Subfamily M
Pseudo No
Location chr18:40065362-40066363 (-)
Aliases cOR5BG2, cOR5BG2

Sequence information


Nucleotide sequence

ATGCTGAGGTTGTTGTTAATATTGCCATCACTATCGTGCCACCACTTCAGAAGTCCAGGG
ACACTGCGGAGAATGGAGTTGGAGAACCACACTGTGAAGTCTGAGTTCTTTCTCTTGGGA
TTTAGTGACCATCCAGAACTTTGGAGGGTGCTTTTTGTTATGTTTCTTTTTATCTACTCT
GTTACCCTCATGGGGAACCTTGGGATGATCTTATTAATCACAACTAGTTCCCATTTGCAC
ACCCCGATGTACTTTTTCCTCTGTATATTGTCCTTTGTAGATGTATGTTACTCTTCTGTT
ATTGCCCCCAAATTACTTGTGGACTTGATTTCCAAAGAAAAGACCATTTCTTACAAGGGC
TGTGCTGCACAGTTATATTTTTTCTGCTCTTTGGTTGACACAGAATCTTTCCTCTTGGCT
GCTATGGCTTATGACCGGTACATAGCAATCTGCAACCCTCTGCTTTATATGGTTATTATG
TCCAAGAGGGTTTGCTCCCAGTTTGCCATTGGAGCATTTTTGGGAGGTACCATGAGTTCA
ATTATTCACACTACTAATACCTTCCATCTGTCTTTCTGCTCCAAAGAAATTAATCATTTC
TTCTGTGATATCTCCCCACTCTTCTCTCTGTCCTGCACTGATACTTACATGCATGACATC
ATTCTGGTAGTCTTTGCTGGTTTGGTGGAAGCTATCTGTCTTCTAGCAGTCCTTCTGTCT
TATGTCTGCATCATAGCAGCTATTCTTAAAACAGGGTCTGCTGAAGGAAGAAAGAAAGGG
TTTTCCACTTGTGCCTCCCATCTGACCGTAGTCACGATCTACCATGGTACCCTCATTTTT
ATTTATTTGCGCCCCAGCACTGGTCATTCGCTGGATATTGACAAAGTGACCTCTGTGTTC
TATACATTGATCATACCTATGTTGAACCCCTTAATTTACAGTCTAAGGAACAAAGACGTC
AAAAATGCCTTTAGGAAAGTAATAGGCAGAAAATTGCTTTCT


Conceptual translation

MLRLLLILPSLSCHHFRSPGTLRRMELENHTVKSEFFLLGFSDHPELWRVLFVMFLFIYS
VTLMGNLGMILLITTSSHLHTPMYFFLCILSFVDVCYSSVIAPKLLVDLISKEKTISYKG
CAAQLYFFCSLVDTESFLLAAMAYDRYIAICNPLLYMVIMSKRVCSQFAIGAFLGGTMSS
IIHTTNTFHLSFCSKEINHFFCDISPLFSLSCTDTYMHDIILVVFAGLVEAICLLAVLLS
YVCIIAAILKTGSAEGRKKGFSTCASHLTVVTIYHGTLIFIYLRPSTGHSLDIDKVTSVF
YTLIIPMLNPLIYSLRNKDVKNAFRKVIGRKLLS