Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR9Q3 Olfactory Receptor

Gene Symbol OR9Q3
Organism Dog
Family 9
Subfamily Q
Pseudo No
Location chr18:38151625-38152626 (-)
Aliases cOR9Q3, cOR9Q3

Sequence information


Nucleotide sequence

ATGACTTGCACTTGCCTCCAGCCCCCTCACCTGCCTCTCCTGTCAGTCCTCCGCAGGCAC
ATGGCCAGGAGGAACCACACCATCGTGACCGAGTTCTTCCTCACTGCATTCAGCGAGCAT
CCTGAGTGGGGGCTTCCTCTCTTCCTGCTGTTTTTGGGTTTTTATGTCATCACCTTGTTG
GGGAACGCGGGGATGGTCCTTCTGATCCGAGTGGATGGCCGGCTGCACACCCCGATGTAC
TTCCTCCTCGGCCACCTGTCCTTCGTGGACATCTGCTACTCGTCCACCATCGTGCCGCAG
ATGCTGGCGGTGCTGCTGCAGCGGGGGGCAGCGCTGTCCTACACCTGCTGCGCCGCTCAG
TTCTTCCTCTTCACCTTCTTTGCTTCCATCGACTGCTACCTGCTGGCTCTCATGGCCTAT
GACCGCTACGTGGCCGTGTGCCGGCCCCTGCTGTATGTCACCATCATGACCGAGAAGGCG
CGCTGGGGCTTCGTGGCTGGGGCTTATGGGGCTGGTTTCTCCAGCGCCTTTGTTCGAACA
ATCACAGCCTTCTCCCTCTCCTTCTGCGGGGACAACGAGATTGACTTTATTTTCTGTGAC
CTTCCCCCTCTGTTAAAGCTGACCTGTGGGGACAGCTACACCCAGGAGGTGGTCATTGTT
GTGTTTGCCATCTTTGTCATGCCTATTTGTGTGGTGGCGATCTTGGTGTCCTACCTGTTT
ATTGTTGTGGCCATCATGAGGATCCCCTCTGCGGGGGGCCGGGCCAAGACCTTCTCTACC
TGCGCCTCTCACCTCACGGCTGTGTCCCTCTTCTTCGGCACCCTCATCTTCATGTACCTG
CGAGGTAACGAGGACCAGCCCTCCGAGGGAGACCGAGTGGTGTCAGTGCTCTACACAGTG
GTGACCCCTCTGCTGAACCCCTTCATCTATAGTCTGAGGAATAAGGAAGTGAAGGAGGCG
TTTAGGAAAGCTCTGAACAGGCCAAAGGCTTCTGGAAGGACC


Conceptual translation

MTCTCLQPPHLPLLSVLRRHMARRNHTIVTEFFLTAFSEHPEWGLPLFLLFLGFYVITLL
GNAGMVLLIRVDGRLHTPMYFLLGHLSFVDICYSSTIVPQMLAVLLQRGAALSYTCCAAQ
FFLFTFFASIDCYLLALMAYDRYVAVCRPLLYVTIMTEKARWGFVAGAYGAGFSSAFVRT
ITAFSLSFCGDNEIDFIFCDLPPLLKLTCGDSYTQEVVIVVFAIFVMPICVVAILVSYLF
IVVAIMRIPSAGGRAKTFSTCASHLTAVSLFFGTLIFMYLRGNEDQPSEGDRVVSVLYTV
VTPLLNPFIYSLRNKEVKEAFRKALNRPKASGRT