Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR9S12 Olfactory Receptor

Gene Symbol OR9S12
Organism Dog
Family 9
Subfamily S
Pseudo No
Location chr25:50198669-50199634 (+)
Aliases cOR9S12P

Sequence information


Nucleotide sequence

ATGCCATCCCACAGTAATGAAAACCTCTCCATGGTCTACTTTCAAGATTTTGTGCTGGAG
GGATTTGGGGGTGGCCTGGAGACCCAGGCGCTACTCTTCACACTGTTTCTGGCCCTGTAC
ATGGTGACTCTGCTGGGGAACATTCTCATGATCATCATAATTACCCTGGATGCCCGCCTG
CACTCCCCAATGTACTTCTTCCTCAAGAACCTCTCCTTCGTGGACTTGTGCTACTCATCT
GTGATCGCCCCCAATGCACTGGCCAACTTCTTCTCCTCATCCAAGGTCATCACCTTTGCA
GGATGTGCCACCCAGTTTTTCTTTATCTCCCTGCTGGCCACCACTGAATGCTTCTTCCTG
GGTGTGATGGCGTATGACCGCTTCATGGCCATCTGTAGCCCTTTGCGCTACCCAAGTACC
ATGTGCCAGTCTGCCTGCACTCGCCTGGTGCTGGGCGCCTACTGTGGAGGCTGCTTCAAC
TCTGTTGTGCAGACCAGCTTCACATTCCACCTCCCATTCTGCAGCTCCAACCGCATCAAC
CACTTCTTCTGTGATGTGCCCCCTCTGCTCCAGATCGCCTGTGGCAACACGGCCATCAAT
GAACTTCTTCTGTTTGGCATCTGTGGGCTCATCATTGTGGGTGTGATGTTTGTGATCCTC
ATCTCCTATGGCTACATCACAGTGACCATCCTGAGGATGCGGTCAGGAACTGGGAGACAC
AAGATCTTCTCCACCTGTGGCTCCCACATGACTGTAGTGACTCTCTTTTTTGGGACTGCC
TTTGTCATGTATGCCCAGCCAGGAGCAATTGAATCCATGGAGCAGGGCAAGGTGGTCTCT
GTCTTCTACACGCTGGTCATCCCAATGCTCAATCCCCTCATCTACAGTCTGCGAAACAAG
GATGTGAAGGAGGCTGTGCAGAGGCTGGGCCAGAAACACATGGCCATACGAAGGATGTGC
TGTTGG


Conceptual translation

MPSHSNENLSMVYFQDFVLEGFGGGLETQALLFTLFLALYMVTLLGNILMIIIITLDARL
HSPMYFFLKNLSFVDLCYSSVIAPNALANFFSSSKVITFAGCATQFFFISLLATTECFFL
GVMAYDRFMAICSPLRYPSTMCQSACTRLVLGAYCGGCFNSVVQTSFTFHLPFCSSNRIN
HFFCDVPPLLQIACGNTAINELLLFGICGLIIVGVMFVILISYGYITVTILRMRSGTGRH
KIFSTCGSHMTVVTLFFGTAFVMYAQPGAIESMEQGKVVSVFYTLVIPMLNPLIYSLRNK
DVKEAVQRLGQKHMAIRRMCCW